RegulonDB RegulonDB 10.9: Gene Form
   

ymfD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

icd ymfE ymfD C0293 ymfDp7 ymfDp7 ymfDp5 ymfDp5 ymfDp6 ymfDp6 TSS_1490 TSS_1490 TSS_1489 TSS_1489 TSS_1488 TSS_1488 TSS_1487 TSS_1487 TSS_1486 (cluster) TSS_1486 (cluster)

Gene      
Name: ymfD    Texpresso search in the literature
Synonym(s): ECK1123, G6582, b1137
Genome position(nucleotides): 1196867 <-- 1197532 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
34.83
External database links:  
ASAP:
ABE-0003825
ECHOBASE:
EB3222
ECOLIHUB:
ymfD
OU-MICROARRAY:
b1137
STRING:
511145.b1137
COLOMBOS: ymfD


Product      
Name: e14 prophage; putative SAM-dependent methyltransferase YmfD
Synonym(s): YmfD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.147
Isoelectric point: 9.033
Motif(s):
 
Type Positions Sequence
44 -> 145 LDFGCGKLRYSDELISKFDEVTFLDSKRQLEREQIIRGIKTKIIDYVPRYYKNANTVAFEDVDKIIGGYDFILCSNVLSAVPCRDTIDKIVLSIKRLLKSGG

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12717N
ECOCYC:
G6582-MONOMER
ECOLIWIKI:
b1137
INTERPRO:
IPR013217
INTERPRO:
IPR029063
MODBASE:
P75967
PFAM:
PF08242
PRIDE:
P75967
REFSEQ:
NP_415655
UNIPROT:
P75967


Operon      
Name: ymfED         
Operon arrangement:
Transcription unit        Promoter
ymfED


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ymfDp6 1197589 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ymfDp5 1197625 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ymfDp7 1197661 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB