RegulonDB RegulonDB 10.8: Gene Form
   

xisE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

intE lit ymfH xisE terminator TSS_1491 TSS_1491

Gene      
Name: xisE    Texpresso search in the literature
Synonym(s): ECK1127, G6585, b1141, ymfG
Genome position(nucleotides): 1200787 <-- 1201032 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.31
External database links:  
ASAP:
ABE-0003838
ECHOBASE:
EB3995
OU-MICROARRAY:
b1141
PortEco:
xisE
STRING:
511145.b1141
COLOMBOS: xisE


Product      
Name: e14 prophage; putative excisionase
Synonym(s): XisE, YmfG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.287
Isoelectric point: 10.16
Motif(s):
 
Type Positions Sequence
5 -> 75 LTLEEWAAEKYRSNPPSVSTLRRYAKQNLFCPPAMKQGRLWRVREDAELVGELVTPVIKKNDSLLLQRILS

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0006310 - DNA recombination
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6585-MONOMER
ECOLIWIKI:
b1141
INTERPRO:
IPR012884
INTERPRO:
IPR038137
INTERPRO:
IPR009061
PFAM:
PF07825
PRIDE:
P75970
PRODB:
PRO_000024236
REFSEQ:
NP_415659
SMR:
P75970
UNIPROT:
P75970


Operon      
Name: ymfH-xisE-intE         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1491 1201113 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB