RegulonDB RegulonDB 10.8: Gene Form
   

ymfT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ymfK ymfL nc10 ymfT ymfM terminator terminator cohEp10 cohEp10 cohEp9 cohEp9 croEp5 croEp5 cohEp8 cohEp8 TSS_1497 TSS_1497 TSS_1496 TSS_1496 croEp4 croEp4 ymfJp9 ymfJp9

Gene      
Name: ymfT    Texpresso search in the literature
Synonym(s): ECK1132, G6590, b1146, croE
Genome position(nucleotides): 1203024 --> 1203224 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.79
External database links:  
ASAP:
ABE-0003856
ECHOBASE:
EB4333
OU-MICROARRAY:
b1146
PortEco:
ymfT
STRING:
511145.b1146
COLOMBOS: ymfT


Product      
Name: e14 prophage; putative DNA-binding transcriptional regulator YmfT
Synonym(s): CroE, YmfT
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 7.402
Isoelectric point: 9.926
Motif(s):
 
Type Positions Sequence
13 -> 64 QGELAGKVGSTPGYLRLVFNGYKKASFVLAKKLEQYTSGAITKSDLRPDIYP

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
molecular_function GO:0003677 - DNA binding
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6590-MONOMER
ECOLIWIKI:
b1146
INTERPRO:
IPR010982
INTERPRO:
IPR031856
PFAM:
PF15943
PRIDE:
P75975
REFSEQ:
NP_415664
SMR:
P75975
UNIPROT:
P75975


Operon      
Name: ymfTLMNR-beeE-jayE-ymfQ-ycfK-tfaP         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ymfJp9 1202259 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter croEp4 1202883 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1496 1202924 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1497 1202933 reverse nd [RS-EPT-CBR] [2]
  promoter cohEp8 1202955 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter croEp5 1203006 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter cohEp9 1203014 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter cohEp10 1203088 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB