RegulonDB RegulonDB 10.8: Gene Form
   

ymfN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ymfN aaaE ymfM oweE ymfR ymfL

Gene      
Name: ymfN    Texpresso search in the literature
Synonym(s): ECK1135, G6593, b1149
Genome position(nucleotides): 1204170 --> 1205537 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.31
External database links:  
ASAP:
ABE-0003865
ECHOBASE:
EB4000
OU-MICROARRAY:
b1149
PortEco:
ymfN
STRING:
316407.4062724
COLOMBOS: ymfN


Product      
Name: e14 prophage; chimeric replication protein/phage terminase YmfN
Synonym(s): YmfN, e14 prophage; phage terminase-like protein YmfN, e14 prophage; putative DNA-binding transcriptional regulator
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 50.871
Isoelectric point: 4.8
Motif(s):
 
Type Positions Sequence
24 -> 70 AIMARLADFSNDEGVCWPSIETIARQIGAGMSTVRTAIARLEAEGWL
78 -> 436 GDGSSPHCAVVDEYHEHATDALYTTMLTGMGARRQPLMWAITTAGYNIEGPCYDKRREVIEMLNGSVPNDELFGIIYTVDEGDDWTDPQVLEKANPNIGVSVYREFLLSQQQRAKNNARLANVFKTKHLNIWASARSAYFNLVSWQSCEDKSLTLEQFEGQPCILAFDLARKLDMNSMARLYTREIDGKTHYYSVAPRFWVPYDTVYSVEKNEDRRTAERFQKWVEMGVLTVTDGAEVDYRYILEEAKAANKISPVSESPIDPFGATGLSHDLADEDLNPVTIIQNYTNMSDPMKELEAAIESGRFHHDGNPIMTWCIGNVVGKTIPGNDDVVKPVKEQAENKIDGAVALIMAVGRAML

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12724N
ECOCYC:
G6593-MONOMER
ECOLIWIKI:
b1149
INTERPRO:
IPR036388
INTERPRO:
IPR005021
INTERPRO:
IPR036390
MINT:
MINT-1257432
PANTHER:
PTHR41287
PFAM:
PF03354
PRIDE:
P75978
REFSEQ:
NP_415667
SMR:
P75978
UNIPROT:
P75978


Operon      
Name: ymfTLMNR-beeE-jayE-ymfQ-ycfK-tfaP         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB