RegulonDB RegulonDB 10.8: Gene Form
   

beeE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ymfN aaaE jayE ymfQ beeE ymfR oweE

Gene      
Name: beeE    Texpresso search in the literature
Synonym(s): ECK1137, G6595, b1151, ymfO
Genome position(nucleotides): 1205731 --> 1206204 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.33
External database links:  
ASAP:
ABE-0003870
ECHOBASE:
EB4001
ECOO157CYC:
Z1849
OU-MICROARRAY:
b1151
PortEco:
ymfO
STRING:
316407.4062726
COLOMBOS: beeE


Product      
Name: e14 prophage; protein BeeE
Synonym(s): BeeE, YmfO
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 17.609
Isoelectric point: 8.478
Motif(s):
 
Type Positions Sequence
47 -> 136 AVFSCVRVLAESVGMLPCNLYHLNGSLKQRATGERLHKLISTHPNGYMTPQEFWELVVTCLCLRGNFYAYKVKAFGEVAELLPVDPGCVV

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6595-MONOMER
ECOLIWIKI:
b1151
ECOO157CYC:
Z1849-MONOMER
INTERPRO:
IPR006944
PFAM:
PF04860
PRIDE:
P75980
REFSEQ:
NP_415669
SMR:
P75980
UNIPROT:
P75980


Operon      
Name: ymfTLMNR-beeE-jayE-ymfQ-ycfK-tfaP         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB