RegulonDB RegulonDB 10.9: Gene Form
   

ymfQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

jayE ycfK ymfQ beeE

Gene      
Name: ymfQ    Texpresso search in the literature
Synonym(s): ECK1139, G6597, b1153
Genome position(nucleotides): 1206913 --> 1207497 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.26
External database links:  
ASAP:
ABE-0003874
ECHOBASE:
EB4003
ECOLIHUB:
ymfQ
OU-MICROARRAY:
b1153
STRING:
511145.b1153
COLOMBOS: ymfQ


Product      
Name: e14 prophage; DUF2313 domain-containing protein YmfQ
Synonym(s): YmfQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 21.644
Isoelectric point: 4.8
Motif(s):
 
Type Positions Sequence
33 -> 194 APSLTRVHQRADALMRELDPRTTTELINRWERLCGLPDECIPAGTQTLRQRQQRLDAKVNLAGGINEDFYLAQLAALGRPDATITRYDKSTFTCSSACTDAVNAPEWRYYWQVNMPATTNSTWMTCGDPCDSALRIWGDTVVECVLNKLCPSHTYVIFKYPE
12 -> 192 LSALLPPGPVWSASDPAIAGAAPSLTRVHQRADALMRELDPRTTTELINRWERLCGLPDECIPAGTQTLRQRQQRLDAKVNLAGGINEDFYLAQLAALGRPDATITRYDKSTFTCSSACTDAVNAPEWRYYWQVNMPATTNSTWMTCGDPCDSALRIWGDTVVECVLNKLCPSHTYVIFKY
1 -> 32 MDVTNDDYIRLLSALLPPGPVWSASDPAIAGA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
G6597-MONOMER
ECOLIWIKI:
b1153
INTERPRO:
IPR018755
PFAM:
PF10076
PRIDE:
P75982
REFSEQ:
NP_415671
UNIPROT:
P75982


Operon      
Name: ymfTLMNR-beeE-jayE-ymfQ-ycfK-tfaP         
Operon arrangement:
Transcription unit        Promoter
ymfTLMNR-beeE-jayE-ymfQ-ycfK-tfaP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056


RegulonDB