RegulonDB RegulonDB 10.9: Gene Form
   

tfaP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: tfaP    Texpresso search in the literature
Synonym(s): ECK1141, G6598, b1155, ymfS
Genome position(nucleotides): 1208132 --> 1208545 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.03
External database links:  
ASAP:
ABE-0003878
ECHOBASE:
EB4083
ECOLIHUB:
ymfS
OU-MICROARRAY:
b1155
STRING:
511145.b1155
COLOMBOS: tfaP


Product      
Name: e14 prophage; putative tail fiber assembly protein TfaP
Synonym(s): TfaP, YmfS
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.434
Isoelectric point: 4.253
Motif(s):
 
Type Positions Sequence
44 -> 44 V
66 -> 66 A
57 -> 132 VIRTHDDEVADANFQKQMLISDATDFINSRQWQGKAALGRLKEDELKQYNLWLDYLEALELVDTSSAPDIEWPTPP

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12729N
ECOCYC:
G6598-MONOMER
ECOLIWIKI:
b1155
INTERPRO:
IPR003458
PFAM:
PF02413
PRIDE:
P09154
REFSEQ:
NP_415673
UNIPROT:
P09154


Operon      
Name: ymfTLMNR-beeE-jayE-ymfQ-ycfK-tfaP         
Operon arrangement:
Transcription unit        Promoter
ymfTLMNR-beeE-jayE-ymfQ-ycfK-tfaP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter tfaEp6 1209189 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter tfaEp1 1209266 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter pinEp1 1209527 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter pinEp3 1209672 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter mcrAp7 1210139 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter mcrAp10 1210195 forward Similarity to the consensus
Read more >
[ICWHO] [1]



RegulonDB