RegulonDB RegulonDB 10.9: Gene Form
   

ycgX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

bluR ycgX ymgL ycgXp4 ycgXp4 TSS_1498 TSS_1498 ycgXp5 ycgXp5

Gene      
Name: ycgX    Texpresso search in the literature
Synonym(s): ECK1148, G6601, b1161
Genome position(nucleotides): 1212703 <-- 1213107 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
36.79
External database links:  
ASAP:
ABE-0003897
ECHOBASE:
EB3994
ECOLIHUB:
ycgX
OU-MICROARRAY:
b1161
STRING:
511145.b1161
COLOMBOS: ycgX


Product      
Name: DUF1398 domain-containing protein YcgX
Synonym(s): YcgX
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 15.769
Isoelectric point: 9.311
Motif(s):
 
Type Positions Sequence
8 -> 125 QKMFEQVRKEQNFSWFYSELKHHRIAHYIYYLATDNIRIITHDDTVLLLRGTRNLLKVSTTKNPAKIKEAALLHICGKSTFREYCSTLAGAGVFRWVTDVNHNKRSYYAIDNTLLYIE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11564N
ECOCYC:
G6601-MONOMER
ECOLIWIKI:
b1161
INTERPRO:
IPR009833
INTERPRO:
IPR036696
PFAM:
PF07166
PRIDE:
P75988
REFSEQ:
NP_415679
SMR:
P75988
UNIPROT:
P75988


Operon      
Name: ycgX         
Operon arrangement:
Transcription unit        Promoter
ycgX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ycgXp5 1213212 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1498 1213280 reverse nd [RS-EPT-CBR] [2]
  promoter ycgXp4 1213284 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB