RegulonDB RegulonDB 10.9: Gene Form
   

bluF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

bluF bluR ycgZ RcdA BluR RcdA MarA ycgZp ycgZp bluFp7 bluFp7 bluFp bluFp bluRp bluRp

Gene      
Name: bluF    Texpresso search in the literature
Synonym(s): ECK1150, G6603, b1163, ycgF
Genome position(nucleotides): 1214264 <-- 1215475 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.56
External database links:  
ASAP:
ABE-0003903
ECHOBASE:
EB3646
ECOLIHUB:
ycgF
OU-MICROARRAY:
b1163
STRING:
511145.b1163
COLOMBOS: bluF


Product      
Name: blue light- and temperature-regulated antirepressor BluF
Synonym(s): Blrp, BluF, YcgF, blue light-responsive regulator of BluR
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 45.295
Isoelectric point: 4.813
Motif(s):
 
Type Positions Sequence
193 -> 195 IVQ
2 -> 92 LTTLIYRSHIRDDEPVKKIEEMVSIANRRNMQSDVTGILLFNGSHFFQLLEGPEEQVKMIYRAICQDPRHYNIVELLCDYAPARRFGKAGM
155 -> 403 DGSDKELDSCALSPTINDHFAFHPIVDPLSRRIIAFEAIVQKNEDSPSAIAVGQRKDGEIYTADLKSKALAFTMAHALELGDKMISINLLPMTLVNEPDAVSFLLNEIKANALVPEQIIVEFTESEVISRFDEFAEAIKSLKAAGISVAIDHFGAGFAGLLLLSRFQPDRIKISQELITNVHKSGPRQAIIQAIIKCCTSLEIQVSAMGVATPEEWMWLESAGIEMFQGDLFAKAKLNGIPSIAWPEKK
98 -> 144 RLHERDDVLQAVFDKGTSKFQLTYDDRALQFFRTFVLATEQSTYFEI
173 -> 388 HFAFHPIVDPLSRRIIAFEAIVQKNEDSPSAIAVGQRKDGEIYTADLKSKALAFTMAHALELGDKMISINLLPMTLVNEPDAVSFLLNEIKANALVPEQIIVEFTESEVISRFDEFAEAIKSLKAAGISVAIDHFGAGFAGLLLLSRFQPDRIKISQELITNVHKSGPRQAIIQAIIKCCTSLEIQVSAMGVATPEEWMWLESAGIEMFQGDLFAK

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional
Gene Ontology Terms (GO)  
molecular_function GO:0050660 - flavin adenine dinucleotide binding
GO:0070491 - repressing transcription factor binding
GO:0009881 - photoreceptor activity
GO:0071949 - FAD binding
GO:0009882 - blue light photoreceptor activity
GO:0033613 - activating transcription factor binding
biological_process GO:0050896 - response to stimulus
GO:0043433 - negative regulation of DNA-binding transcription factor activity
GO:0018298 - protein-chromophore linkage
GO:0009637 - response to blue light
GO:0009785 - blue light signaling pathway
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[IDA] Inferred from direct assay
Reference(s): [1] Rajagopal S., et al., 2004
[2] Terazima M. 2011
[3] Tschowri N., et al., 2009
[4] Weber S., et al., 2011
[5] Yee EF., et al., 2019
External database links:  
DIP:
DIP-11553N
ECOCYC:
G6603-MONOMER
ECOLIWIKI:
b1163
INTERPRO:
IPR035919
INTERPRO:
IPR007024
INTERPRO:
IPR001633
INTERPRO:
IPR036046
PFAM:
PF04940
PFAM:
PF00563
PRIDE:
P75990
PROSITE:
PS50925
PROSITE:
PS50883
REFSEQ:
NP_415681
SMART:
SM00052
SMART:
SM01034
SMR:
P75990
UNIPROT:
P75990


Operon      
Name: bluF         
Operon arrangement:
Transcription unit        Promoter
bluF


Transcriptional Regulation      
Display Regulation             
Activated by: RcdA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter bluFp7 1215613 reverse Similarity to the consensus
Read more >
[ICWHO] [6]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Rajagopal S., Key JM., Purcell EB., Boerema DJ., Moffat K., 2004, Purification and initial characterization of a putative blue light-regulated phosphodiesterase from Escherichia coli., Photochem Photobiol 80(3):542-7

 [2] Terazima M., 2011, Time-dependent intermolecular interaction during protein reactions., Phys Chem Chem Phys 13(38):16928-40

 [3] Tschowri N., Busse S., Hengge R., 2009, The BLUF-EAL protein YcgF acts as a direct anti-repressor in a blue-light response of Escherichia coli., Genes Dev 23(4):522-34

 [4] Weber S., Schroeder C., Kacprzak S., Mathes T., Kowalczyk RM., Essen LO., Hegemann P., Schleicher E., Bittl R., 2011, Light-generated paramagnetic intermediates in BLUF domains., Photochem Photobiol 87(3):574-83

 [5] Yee EF., Chandrasekaran S., Lin C., Crane BR., 2019, Physical methods for studying flavoprotein photoreceptors., Methods Enzymol 620:509-544

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB