RegulonDB RegulonDB 10.9: Gene Form
   

ycgV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycgV dhaR ychF ycgVp10 ycgVp10 ycgVp9 ycgVp9 TSS_1533 TSS_1533

Gene      
Name: ycgV    Texpresso search in the literature
Synonym(s): ECK1190, G6629, b1202
Genome position(nucleotides): 1253085 <-- 1255952 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.79
External database links:  
ASAP:
ABE-0004035
ECHOBASE:
EB3662
ECOLIHUB:
ycgV
OU-MICROARRAY:
b1202
STRING:
511145.b1202
COLOMBOS: ycgV


Product      
Name: putative autotransporter adhesin YcgV
Synonym(s): YcgV
Sequence: Get amino acid sequence Fasta Format
Cellular location: membrane
Molecular weight: 99.685
Isoelectric point: 4.838
Motif(s):
 
Type Positions Sequence
694 -> 935 IWLRSYGGSLDSFASGKLSGFDMGYSGIQFGGDKRLSDVMPLYVGLYIGSTHASPDYSGGDGTARSDYMGMYASYMAQNGFYSDLVIKASRQKNSFHVLDSQNNGVNANGTANGMSISLEAGQRFNLSPTGYGFYIEPQTQLTYSHQNEMTMKASNGLNIHLNHYESLLGRASMILGYDITAGNSQLNVYVKTGAIREFSGDTEYLLNNSREKYSFKGNGWNNGVGVSAQYNKQHTFYLEAD
494 -> 615 LDTLALSHSTVDFASHGSTAGTFATLNVENLSGNSTFIMRADVVGEGNGVNNKGDLLNISGSSAGNHVLAIRNQGSEATTGNEVLTVVKTTDGAASFSASSQVELGGYLYDVRKNGTNWELY
687 -> 955 NQSKDGNIWLRSYGGSLDSFASGKLSGFDMGYSGIQFGGDKRLSDVMPLYVGLYIGSTHASPDYSGGDGTARSDYMGMYASYMAQNGFYSDLVIKASRQKNSFHVLDSQNNGVNANGTANGMSISLEAGQRFNLSPTGYGFYIEPQTQLTYSHQNEMTMKASNGLNIHLNHYESLLGRASMILGYDITAGNSQLNVYVKTGAIREFSGDTEYLLNNSREKYSFKGNGWNNGVGVSAQYNKQHTFYLEADYTQGNLFDQKQVNGGYRFSF

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0019867 - outer membrane
molecular_function GO:0015475 - adhesin autotransporter activity
biological_process GO:0043708 - cell adhesion involved in biofilm formation
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
[2] Wells TJ., et al., 2010
External database links:  
ECOCYC:
G6629-MONOMER
ECOLIWIKI:
b1202
INTERPRO:
IPR006315
INTERPRO:
IPR036709
INTERPRO:
IPR011050
INTERPRO:
IPR005546
INTERPRO:
IPR004899
INTERPRO:
IPR003991
PFAM:
PF03797
PFAM:
PF03212
PRIDE:
P76017
PRINTS:
PR01484
PROSITE:
PS51208
REFSEQ:
NP_415720
SMART:
SM00869
SMR:
P76017
UNIPROT:
P76017


Operon      
Name: ycgV         
Operon arrangement:
Transcription unit        Promoter
ycgV


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1533 1252373 reverse nd [RS-EPT-CBR] [3]
  promoter ycgVp9 1256110 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter ycgVp10 1256111 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Wells TJ., Totsika M., Schembri MA., 2010, Autotransporters of Escherichia coli: a sequence-based characterization., Microbiology 156(Pt 8):2459-69

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB