RegulonDB RegulonDB 10.9: Gene Form
   

ychQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: ychQ    Texpresso search in the literature
Synonym(s): ECK1201, G6630, b1213, sirB2
Genome position(nucleotides): 1266924 --> 1267316 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.58
External database links:  
ASAP:
ABE-0004071
ECHOBASE:
EB4041
ECOLIHUB:
ychQ
OU-MICROARRAY:
b1213
STRING:
511145.b1213
COLOMBOS: ychQ


Product      
Name: SirB family protein YchQ
Synonym(s): YchQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 14.639
Isoelectric point: 11.301
Motif(s):
 
Type Positions Sequence
10 -> 28 VHLISIALSVGLLTLRFWL
74 -> 93 WLTEKLFGVIIYIVLGFIAL
105 -> 124 IIAFPLALVVLYIIIKLATT
6 -> 127 TLLSVHLISIALSVGLLTLRFWLRYQKHPQAFARWTRIVPPVVDTLLLLSGIALMAKAHILPFSGQAQWLTEKLFGVIIYIVLGFIALDYRRMHSQQARIIAFPLALVVLYIIIKLATTKVP
40 -> 59 WTRIVPPVVDTLLLLSGIAL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6630-MONOMER
ECOLIWIKI:
b1213
INTERPRO:
IPR007360
PANTHER:
PTHR39594
PFAM:
PF04247
PRIDE:
Q46755
PRODB:
PRO_000023951
REFSEQ:
NP_415731
UNIPROT:
Q46755


Operon      
Name: ychQA-kdsA         
Operon arrangement:
Transcription unit        Promoter
ychQA-kdsA
kdsA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1545 1265281 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1546 1265487 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1547 (cluster) 1267181 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1548 1267190 forward nd [RS-EPT-CBR] [1]



RegulonDB