RegulonDB RegulonDB 10.9: Gene Form
   

ycjM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycjM ycjN pspE terminator anti-terminator anti-anti-terminator TSS_1744 TSS_1744 ycjMp3 ycjMp3 ycjMp4 ycjMp4

Gene      
Name: ycjM    Texpresso search in the literature
Synonym(s): ECK1304, G6647, b1309, ggaP
Genome position(nucleotides): 1370216 --> 1371895 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.87
External database links:  
ASAP:
ABE-0004400
ECHOBASE:
EB3669
ECOLIHUB:
ycjM
OU-MICROARRAY:
b1309
STRING:
511145.b1309
COLOMBOS: ycjM


Product      
Name: glucosylglycerate phosphorylase
Synonym(s): alpha;-amylase catalytic domain family protein YcjM, GgaP, YcjM, putative glucosyltransferase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 64.186
Isoelectric point: 6.313
Motif(s):
 
Type Positions Sequence
84 -> 338 VHLLPFYPWSSDDGFSVIDYHQVASEAGEWQDIQQLGECSHLMFDFVCNHMSAKSEWFKNYLQQHPGFEDFFIAVDPQTDLSAVTRPRALPLLTPFQMRDHSTRHLWTTFSDDQIDLNYRSPEVLLAMVDVLLCYLAKGAEYVRLDAVGFMWKEPGTSCIHLEKTHLIIKLLRSIIDNVAPGTVIITETNVPHKDNIAYFGAGDDEAHMVYQFSLPPLVLHAVQKQNVEALCAWAQNLTLPSSNTTWFNFLASHD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0110068 - glucosylglycerate phosphorylase activity
GO:0003824 - catalytic activity
GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016740 - transferase activity
biological_process GO:0005975 - carbohydrate metabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Deng D., et al., 2014
[2] Deng D., et al., 2015
External database links:  
CAZY:
GH13
ECOCYC:
G6647-MONOMER
ECOLIWIKI:
b1309
INTERPRO:
IPR033746
INTERPRO:
IPR016377
INTERPRO:
IPR006047
INTERPRO:
IPR017853
MODBASE:
P76041
PFAM:
PF00128
PRIDE:
P76041
REFSEQ:
NP_415825
SMART:
SM00642
UNIPROT:
P76041


Operon      
Name: ycjMNOPQRSTUV-ymjB-ompG         
Operon arrangement:
Transcription unit        Promoter
ompG
ycjMNOPQRSTUV-ymjB-ompG


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ycjMp4 1370003 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ycjMp3 1370185 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_1744 1370189 forward nd [RS-EPT-CBR] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Deng D., Zhang N., Mustapha A., Xu D., Wuliji T., Farley M., Yang J., Hua B., Liu F., Zheng G., 2014, Differentiating enteric Escherichia coli from environmental bacteria through the putative glucosyltransferase gene (ycjM)., Water Res 61:224-31

 [2] Deng D., Zhang N., Xu D., Reed M., Liu F., Zheng G., 2015, Polymorphism of the glucosyltransferase gene (ycjM) in Escherichia coli and its use for tracking human fecal pollution in water., Sci Total Environ 537:260-7

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB