RegulonDB RegulonDB 10.9: Gene Form
   

ycjN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycjM ycjN ycjO ycjP

Gene      
Name: ycjN    Texpresso search in the literature
Synonym(s): ECK1305, G6648, b1310
Genome position(nucleotides): 1371909 --> 1373201 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.04
External database links:  
ASAP:
ABE-0004402
ECHOBASE:
EB3670
ECOLIHUB:
ycjN
ECOO157CYC:
Z2473
ECOO157CYC:
Z2474
OU-MICROARRAY:
b1310
STRING:
511145.b1310
COLOMBOS: ycjN


Product      
Name: putative ABC transporter periplasmic binding protein YcjN
Synonym(s): YcjN
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 46.808
Isoelectric point: 4.673
Motif(s):
 
Type Positions Sequence
1 -> 19 MIKSKIVLLSALVSCALIS
20 -> 430 GCKEENKTNVSIEFMHSSVEQERQAVISKLIARFEKENPGITVKQVPVEEDAYNTKVITLSRSGSLPEVIETSHDYAKVMDKEQLIDRKAVATVISNVGEGAFYDGVLRIVRTEDGSAWTGVPVSAWIGGIWYRKDVLAKAGLEEPKNWQQLLDVAQKLNDPANKKYGIALPTAESVLTEQSFSQFALSNQANVFNAEGKITLDTPEMMQALTYYRDLTANTMPGSNDIMEVKDAFMNGTAPMAIYSTYILPAVIKEGDPKNVGFVVPTEKNSAVYGMLTSLTITAGQKTEETEAAEKFVTFMEQADNIADWVMMSPGAALPVNKAVVTTATWKDNDVIKALGELPNQLIGELPNIQVFGAVGDKNFTRMGDVTGSGVVSSMVHNVTVGKADLSTTLQASQKKLDELIEQH
43 -> 325 QAVISKLIARFEKENPGITVKQVPVEEDAYNTKVITLSRSGSLPEVIETSHDYAKVMDKEQLIDRKAVATVISNVGEGAFYDGVLRIVRTEDGSAWTGVPVSAWIGGIWYRKDVLAKAGLEEPKNWQQLLDVAQKLNDPANKKYGIALPTAESVLTEQSFSQFALSNQANVFNAEGKITLDTPEMMQALTYYRDLTANTMPGSNDIMEVKDAFMNGTAPMAIYSTYILPAVIKEGDPKNVGFVVPTEKNSAVYGMLTSLTITAGQKTEETEAAEKFVTFMEQA

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
DIP:
DIP-11605N
ECOCYC:
YCJN-MONOMER
ECOLIWIKI:
b1310
ECOO157CYC:
Z2474-MONOMER
ECOO157CYC:
Z2473-MONOMER
INTERPRO:
IPR006059
MODBASE:
P76042
PFAM:
PF01547
PRIDE:
P76042
REFSEQ:
NP_415826
UNIPROT:
P76042


Operon      
Name: ycjMNOPQRSTUV-ymjB-ompG         
Operon arrangement:
Transcription unit        Promoter
ompG
ycjMNOPQRSTUV-ymjB-ompG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195


RegulonDB