RegulonDB RegulonDB 10.9: Gene Form
   

ycjO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycjN ycjQ ycjO ycjP

Gene      
Name: ycjO    Texpresso search in the literature
Synonym(s): ECK1306, G6649, b1311
Genome position(nucleotides): 1373222 --> 1374103 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.63
External database links:  
ASAP:
ABE-0004405
ECHOBASE:
EB3671
ECOLIHUB:
ycjO
OU-MICROARRAY:
b1311
STRING:
511145.b1311
COLOMBOS: ycjO


Product      
Name: putative ABC transporter membrane subunit YcjO
Synonym(s): YcjO
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 33.225
Isoelectric point: 9.867
Motif(s):
 
Type Positions Sequence
13 -> 33 FALLLLAPSLLLLGGLVAWPM
111 -> 131 LVILSYVTPSISLVFAWKYMF
73 -> 283 LWMTVWYTALVVAGSTVLGLAVAMFFNREFRLRKTARSLVILSYVTPSISLVFAWKYMFNNGYGIVNYLGVDLLHLYEQAPLWFDNPGSSFVLVVLFAIWRYFPYAFISFLAILQTIDKSLYEAAEMDGANAWQRFRIVTLPAIMPVLATVVTLRTIWMFYMFADVYLLTTKVDILGVYLYKTAFAFNDLGKAAAISVVLFIIIFAVILLT
136 -> 156 GIVNYLGVDLLHLYEQAPLWF
262 -> 282 LGKAAAISVVLFIIIFAVILL

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
biological_process GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
YCJO-MONOMER
ECOLIWIKI:
b1311
INTERPRO:
IPR000515
INTERPRO:
IPR035906
PFAM:
PF00528
PRIDE:
P0AFR7
PROSITE:
PS50928
REFSEQ:
NP_415827
UNIPROT:
P0AFR7


Operon      
Name: ycjMNOPQRSTUV-ymjB-ompG         
Operon arrangement:
Transcription unit        Promoter
ompG
ycjMNOPQRSTUV-ymjB-ompG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195


RegulonDB