RegulonDB RegulonDB 10.9: Gene Form
   

ycjT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycjT ycjS ycjV ycjR ycjU

Gene      
Name: ycjT    Texpresso search in the literature
Synonym(s): ECK1311, G6654, b1316
Genome position(nucleotides): 1377884 --> 1380151 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.75
External database links:  
ASAP:
ABE-0004418
ECHOBASE:
EB3676
ECOLIHUB:
ycjT
OU-MICROARRAY:
b1316
STRING:
511145.b1316
COLOMBOS: ycjT


Product      
Name: kojibiose phosphorylase
Synonym(s): YcjT
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 84.867
Isoelectric point: 5.614
Motif(s):
 
Type Positions Sequence
298 -> 677 DYALYHLRIMTPAHDERSSIAAKGLTGEGYKGHVFWDTEVFLLPFHLFSDPTVARSLLRYRWHNLPGAQEKARRNGWQGALFPWESARSGEEETPEFAAINIRTGLRQKVASAQAEHHLVADIAWAVIQYWQTTGDESFIAHEGMALLLETAKFWISRAVRVNDRLEIHDVIGPDEYTEHVNNNAYTSYMARYNVQQALNIARQFGCSDDAFIHRAEMFLKELWMPEIQPDGVLPQDDSFMAKPAINLAKYKAAAGKQTILLDYSRAEVNEMQILKQADVVMLNYMLPEQFSAASCLANLQFYEPRTIHDSSLSKAIHGIVAARCGLLTQSYQFWREGTEIDLGADPHSCDDGIHAAATGAIWLGAIQGFAGVSVRDGEL
681 -> 729 PALPEQWQQLSFPLFWQGCELQVTLDAQRIAIRTSAPVSLRLNGQLITV
333 -> 334 WD
9 -> 237 EPHFSQHTLNKYASLMAQGNGYLGLRASHEEDYTRQTRGMYLAGLYHRAGKGEINELVNLPDVVGMEIAINGEVFSLSHEAWQRELDFASGELRRNVVWRTSNGSGYTIASRRFVSADQLPLIALEITITPLDADASVLISTGIDATQTNHGRQHLDETQVRVFGQHLMQGSYTTQDGRSDVAISCCCKVSGDVQQCYTAKERRLLQHTSAQLHAGETMTLQKLVWIDW
573 -> 574 KQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0033831 - kojibiose phosphorylase activity
GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0016740 - transferase activity
GO:0004553 - hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0030246 - carbohydrate binding
biological_process GO:0008152 - metabolic process
GO:0005975 - carbohydrate metabolic process
Note(s): Note(s): ...[more].
External database links:  
CAZY:
GH65
ECOCYC:
G6654-MONOMER
ECOLIWIKI:
b1316
INTERPRO:
IPR011013
INTERPRO:
IPR012341
INTERPRO:
IPR017045
INTERPRO:
IPR037018
INTERPRO:
IPR005196
INTERPRO:
IPR005195
INTERPRO:
IPR005194
INTERPRO:
IPR008928
MODBASE:
P77154
PFAM:
PF03632
PFAM:
PF03633
PFAM:
PF03636
PRIDE:
P77154
REFSEQ:
NP_415832
SMR:
P77154
UNIPROT:
P77154


Operon      
Name: ycjMNOPQRSTUV-ymjB-ompG         
Operon arrangement:
Transcription unit        Promoter
ompG
ycjMNOPQRSTUV-ymjB-ompG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB