RegulonDB RegulonDB 10.9: Gene Form
   

ycjU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycjT ycjS ycjV ompG ycjU ymjB terminator

Gene      
Name: ycjU    Texpresso search in the literature
Synonym(s): ECK1312, G6655, b1317, pgmB
Genome position(nucleotides): 1380148 --> 1380807 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.52
External database links:  
ASAP:
ABE-0004420
ECHOBASE:
EB3677
ECOLIHUB:
ycjU
OU-MICROARRAY:
b1317
STRING:
511145.b1317
COLOMBOS: ycjU


Product      
Name: β-phosphoglucomutase
Synonym(s): PgmB, YcjU
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.565
Isoelectric point: 5.258
Motif(s):
 
Type Positions Sequence
9 -> 11 DLD
6 -> 189 VIFDLDGVITDTAHLHFQAWQQIAAEIGISIDAQFNESLKGISRDESLRRILQHGGKEGDFNSQERAQLAYRKNLLYVHSLRELTVNAVLPGIRSLLADLRAQQISVGLASVSLNAPTILAALELREFFTFCADASQLKNSKPDPEIFLAACAGLGVPPQACIGIEDAQAGIDAINASGMRSVG
44 -> 49 LKGISR
116 -> 120 SVSLN

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.9 - misc. glucose metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0016853 - isomerase activity
GO:0046872 - metal ion binding
GO:0008801 - beta-phosphoglucomutase activity
GO:0000287 - magnesium ion binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006974 - cellular response to DNA damage stimulus
GO:0046677 - response to antibiotic
GO:0009294 - DNA mediated transformation
Note(s): Note(s): ...[more].
Reference(s): [1] Huang H., et al., 2015
External database links:  
ECOCYC:
G6655-MONOMER
ECOLIWIKI:
b1317
INTERPRO:
IPR036412
INTERPRO:
IPR041492
INTERPRO:
IPR023214
INTERPRO:
IPR006439
INTERPRO:
IPR010972
INTERPRO:
IPR010976
INTERPRO:
IPR023198
MODBASE:
P77366
PDB:
4G9B
PFAM:
PF13419
PRIDE:
P77366
PRINTS:
PR00413
REFSEQ:
NP_415833
SMR:
P77366
SWISSMODEL:
P77366
UNIPROT:
P77366


Operon      
Name: ycjMNOPQRSTUV-ymjB-ompG         
Operon arrangement:
Transcription unit        Promoter
ompG
ycjMNOPQRSTUV-ymjB-ompG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Huang H., Pandya C., Liu C., Al-Obaidi NF., Wang M., Zheng L., Toews Keating S., Aono M., Love JD., Evans B., Seidel RD., Hillerich BS., Garforth SJ., Almo SC., Mariano PS., Dunaway-Mariano D., Allen KN., Farelli JD., 2015, Panoramic view of a superfamily of phosphatases through substrate profiling., Proc Natl Acad Sci U S A 112(16):E1974-83


RegulonDB