RegulonDB RegulonDB 10.9: Gene Form
   

ycjV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycjV ompG ycjU ymjB ycjT terminator

Gene      
Name: ycjV    Texpresso search in the literature
Synonym(s): ECK1313, G6656, b1318
Type: Pseudo Gene
Genome position(nucleotides): 1380821 --> 1381789 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.57
External database links:  
ASAP:
ABE-0004422
ECHOBASE:
EB3678
ECOLIHUB:
ycjV
OU-MICROARRAY:
b1318
STRING:
316407.1742155
COLOMBOS: ycjV


Product      
Name: putative ABC transporter ATP-binding protein YcjV
Sequence: Get amino acid sequence Fasta Format
Isoelectric point: 8.404
Motif(s):
 
Type Positions Sequence
4 -> 235 LSLQHIQKIYDNQVHVVKDFNLEIADKEFIVFVGPSGCGKSTTLRMIAGLEEISGGDLLIDGKRMNDVPAKARNIAMVFQNYALYPHMTVYDNMAFGLKMQKIAKEVIDERVNWAAQILGLREYLKRKPGALSGGQRQRVALGRAIVREAGVFLMDEPLSNLDAKLRVQMRAEISKLHQKLNTTMIYVTHDQTEAMTMATRIVIMKDGIVQQVGAPKTVYNQPANMFVSGFI
37 -> 44 GPSGCGKS

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0043190 - ATP-binding cassette (ABC) transporter complex
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11613N
ECOCYC:
YCJV-MONOMER
ECOLIWIKI:
b1318
INTERPRO:
IPR003593
INTERPRO:
IPR003439
INTERPRO:
IPR008995
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR013611
MODBASE:
P77481
PFAM:
PF00005
PFAM:
PF08402
PRIDE:
P77481
PROSITE:
PS00211
PROSITE:
PS50893
SMART:
SM00382
SMR:
P77481
SWISSMODEL:
P77481
UNIPROT:
P77481


Operon      
Name: ycjMNOPQRSTUV-ymjB-ompG         
Operon arrangement:
Transcription unit        Promoter
ompG
ycjMNOPQRSTUV-ymjB-ompG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB