RegulonDB RegulonDB 10.9: Gene Form
   

ynaI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mppA ynaI insH4 terminator anti-terminator anti-anti-terminator terminator TSS_1756 TSS_1756 TSS_1755 TSS_1755 ynaIp ynaIp insHp7 insHp7

Gene      
Name: ynaI    Texpresso search in the literature
Synonym(s): ECK1327, G6666, b1330
Genome position(nucleotides): 1394891 <-- 1395922 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.22
External database links:  
ASAP:
ABE-0004462
ECHOBASE:
EB3683
ECOLIHUB:
ynaI
OU-MICROARRAY:
b1330
STRING:
511145.b1330
COLOMBOS: ynaI


Product      
Name: small conductance mechanosensitive channel YnaI
Synonym(s): YnaI
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 38.754
Isoelectric point: 9.692
Motif(s):
 
Type Positions Sequence
78 -> 98 IDFICTSLIAVILTIKLFLLI
120 -> 323 RIIKITIIVVLVLLYGEHFGMSLSGLLTFGGIGGLAVGMAGKDILSNFFSGIMLYFDRPFSIGDWIRSPDRNIEGTVAEIGWRITKITTFDNRPLYVPNSLFSSISVENPGRMTNRRITTTIGLRYEDAAKVGVIVEAVREMLKNHPAIDQRQTLLVYFNQFADSSLNIMVYCFTKTTVWAEWLAAQQDVYLKIIDIVQSHGAD
126 -> 146 IIVVLVLLYGEHFGMSLSGLL
10 -> 30 ALNLVIIFGSCAALILMSFWF
41 -> 61 LFHAVQFLIYTIIISAVGSII

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.1 - Channel-type Transporters
  5 - cell processes --> 5.5 - adaptations --> 5.5.1 - osmotic pressure
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0008381 - mechanosensitive ion channel activity
GO:0042802 - identical protein binding
biological_process GO:0006811 - ion transport
GO:0055085 - transmembrane transport
GO:0071470 - cellular response to osmotic stress
External database links:  
DIP:
DIP-12740N
ECOCYC:
MONOMER0-82
ECOLIWIKI:
b1330
INTERPRO:
IPR011066
INTERPRO:
IPR023408
INTERPRO:
IPR011014
INTERPRO:
IPR006686
INTERPRO:
IPR006685
INTERPRO:
IPR010920
MODBASE:
P0AEB5
PFAM:
PF00924
PRIDE:
P0AEB5
PROSITE:
PS01246
REFSEQ:
NP_415846
SMR:
P0AEB5
UNIPROT:
P0AEB5


Operon      
Name: ynaI         
Operon arrangement:
Transcription unit        Promoter
ynaI


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter insHp7 1395971 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1755 1396085 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1756 1397063 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB