RegulonDB RegulonDB 10.9: Gene Form
   

insH4 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ynaI insH4 ynaJ terminator anti-terminator anti-anti-terminator terminator TSS_1757 TSS_1757 TSS_1756 TSS_1756 TSS_1755 TSS_1755 ynaIp ynaIp insHp7 insHp7

Gene      
Name: insH4    Texpresso search in the literature
Synonym(s): ECK0261, G6667, b1331, trs5-4, yi52_4
Genome position(nucleotides): 1396112 --> 1397092 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.05
External database links:  
ASAP:
ABE-0004467
ECOLIHUB:
insH-4
OU-MICROARRAY:
b1331
STRING:
511145.b3505
COLOMBOS: insH4


Product      
Name: IS5 transposase and trans-activator
Synonym(s): InsH4
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 37.851
Isoelectric point: 10.028
Motif(s):
 
Type Positions Sequence
51 -> 124 GRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDRTTIMNFRHLLEQHQLARQLFKT
138 -> 312 QGTLVDATIIEAPSSTKNKEQQRDPEMHQTKKGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVSADAGYQGAPQREELAEVDVDWLIAERPGKVRTLKQHPRKNKTAINIEYMKASIRARVEHPFRIIKRQFGFVKARYKGLLKNDNQLAMLFTLANL

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-4236
ECOLIWIKI:
b1331
INTERPRO:
IPR002559
INTERPRO:
IPR008490
PFAM:
PF05598
PFAM:
PF01609
PRIDE:
P0CE52
REFSEQ:
NP_415847
UNIPROT:
P0CE52


Operon      
Name: insH4         
Operon arrangement:
Transcription unit        Promoter
insH4


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter insHp7 1395971 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1755 1396085 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1756 1397063 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1757 1397329 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB