RegulonDB RegulonDB 10.9: Gene Form
   

ynaJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insH4 uspE ynaJ TSS_1758 TSS_1758 TSS_1757 TSS_1757 TSS_1756 TSS_1756

Gene      
Name: ynaJ    Texpresso search in the literature
Synonym(s): ECK1328, G6668, b1332
Genome position(nucleotides): 1397365 --> 1397622 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.35
External database links:  
ASAP:
ABE-0004470
ECHOBASE:
EB4042
ECOLIHUB:
ynaJ
OU-MICROARRAY:
b1332
STRING:
511145.b1332
COLOMBOS: ynaJ


Product      
Name: DUF2534 domain-containing protein YnaJ
Synonym(s): YnaJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 9.339
Isoelectric point: 9.531
Motif(s):
 
Type Positions Sequence
5 -> 82 KLKSAKGKKFLFGLLAVFIIAASVVTRATIGGVIEQYNIPLSEWTTSMYVIQSSMIFVYSLVFTVLLAIPLGIYFLGG
60 -> 80 IFVYSLVFTVLLAIPLGIYFL
14 -> 34 FLFGLLAVFIIAASVVTRATI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6668-MONOMER
ECOLIWIKI:
b1332
INTERPRO:
IPR019685
PFAM:
PF10749
PRIDE:
P64445
REFSEQ:
NP_415848
UNIPROT:
P64445


Operon      
Name: ynaJ         
Operon arrangement:
Transcription unit        Promoter
ynaJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1756 1397063 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1757 1397329 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1758 1398266 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB