RegulonDB RegulonDB 10.9: Gene Form
   

abgB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

abgT abgB abgA abgR NarL Fis NarL NarL NarL terminator ogtp ogtp

Gene      
Name: abgB    Texpresso search in the literature
Synonym(s): ECK1333, G6669, b1337, ydaI
Genome position(nucleotides): 1401810 <-- 1403255 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.56
External database links:  
ASAP:
ABE-0004491
ECHOBASE:
EB3134
ECOLIHUB:
abgB
OU-MICROARRAY:
b1337
STRING:
511145.b1337
COLOMBOS: abgB


Product      
Name: p-aminobenzoyl-glutamate hydrolase subunit B
Synonym(s): AbgB, YdaI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 52.194
Isoelectric point: 5.525
Motif(s):
 
Type Positions Sequence
80 -> 252 GEYDALAGLSQQAGCAQPTSVTPGENGHGCGHNLLGTAAFAAAIAVKKWLEQYGQGGTVRFYGCPGEEGGSGKTFMVREGVFDDVDAALTWHPEAFAGMFNTRTLANIQASWRFKGIAAHAANSPHLGRSALDAVTLMTTGTNFLNEHIIEKARVHYAITNSGGISPNVVQAQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0016805 - dipeptidase activity
GO:0046982 - protein heterodimerization activity
GO:0071713 - para-aminobenzoyl-glutamate hydrolase activity
biological_process GO:0006508 - proteolysis
GO:0046657 - folic acid catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6669-MONOMER
ECOLIWIKI:
b1337
INTERPRO:
IPR017439
INTERPRO:
IPR036264
INTERPRO:
IPR017145
INTERPRO:
IPR002933
MODBASE:
P76052
PFAM:
PF01546
PRIDE:
P76052
PRODB:
PRO_000022028
REFSEQ:
NP_415853
UNIPROT:
P76052


Operon      
Name: abgABT-ogt         
Operon arrangement:
Transcription unit        Promoter
ogt
abgABT-ogt


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB