RegulonDB RegulonDB 10.9: Gene Form
   

abgA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

abgT abgB abgA abgR NarL Fis NarL NarL NarL terminator ogtp ogtp

Gene      
Name: abgA    Texpresso search in the literature
Synonym(s): ECK1334, G6670, b1338, ydaJ
Genome position(nucleotides): 1403255 <-- 1404565 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.23
External database links:  
ASAP:
ABE-0004493
ECHOBASE:
EB3135
ECOLIHUB:
abgA
OU-MICROARRAY:
b1338
STRING:
511145.b1338
COLOMBOS: abgA


Product      
Name: p-aminobenzoyl-glutamate hydrolase subunit A
Synonym(s): AbgA, YdaJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 46.588
Isoelectric point: 5.753
Motif(s):
 
Type Positions Sequence
231 -> 318 FDAHFTGTAAHAGAKPEDGHNALLAAAQATLALHAIAPHSEGASRVNVGVMQAGSGRNVVPASALLKVETRGASDVINQYVFDRAQQA
112 -> 428 AFRVDMDALDLSEEQDVSHRPYRDGFASCNAGMMHACGHDGHTAIGLGLAHTLKQFESGLHGVIKLIFQPAEEGTRGARAMVDAGVVDDVDYFTAVHIGTGVPAGTVVCGSDNFMATTKFDAHFTGTAAHAGAKPEDGHNALLAAAQATLALHAIAPHSEGASRVNVGVMQAGSGRNVVPASALLKVETRGASDVINQYVFDRAQQAIQGAATMYGVGVETRLMGAATASSPSPQWVAWLQSQAAQVAGVNQAIERVEAPAGSEDATLMMARVQQHQGQASYVVFGTQLAAGHHNEKFDFDEQVLAIAVETLARTAL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0016810 - hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
GO:0016805 - dipeptidase activity
GO:0046982 - protein heterodimerization activity
GO:0071713 - para-aminobenzoyl-glutamate hydrolase activity
biological_process GO:0006508 - proteolysis
GO:0046657 - folic acid catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6670-MONOMER
ECOLIWIKI:
b1338
INTERPRO:
IPR036264
INTERPRO:
IPR033845
INTERPRO:
IPR002933
INTERPRO:
IPR011650
INTERPRO:
IPR017439
MODBASE:
P77357
PFAM:
PF01546
PFAM:
PF07687
PRIDE:
P77357
PRODB:
PRO_000022027
REFSEQ:
NP_415854
SMR:
P77357
UNIPROT:
P77357


Operon      
Name: abgABT-ogt         
Operon arrangement:
Transcription unit        Promoter
ogt
abgABT-ogt


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB