RegulonDB RegulonDB 10.9: Gene Form
   

smrA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dgcM smrA mcaS CRP TSS_1764 TSS_1764 TSS_1763 TSS_1763 TSS_1762 TSS_1762 smrAp1 smrAp1 TSS_1761 TSS_1761 mcaSp mcaSp

Gene      
Name: smrA    Texpresso search in the literature
Synonym(s): ECK1337, G6672, b1340, ydaL
Genome position(nucleotides): 1405979 --> 1406542 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.26
External database links:  
ASAP:
ABE-0004502
ECHOBASE:
EB3137
ECOLIHUB:
ydaL
OU-MICROARRAY:
b1340
STRING:
511145.b1340
COLOMBOS: smrA


Product      
Name: DNA endonuclease SmrA
Synonym(s): SmrA, YdaL, conserved protein with endonuclease activity SmrA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.512
Isoelectric point: 9.531
Motif(s):
 
Type Positions Sequence
40 -> 40 D
45 -> 45 D
88 -> 169 LNLLRQPVEECRKMVFSFIQQALADGLRNVLIIHGKGRDDKSHANIVRSYVARWLTEFDDVQAYCTALPHHGGSGACYVALR
89 -> 169 NLLRQPVEECRKMVFSFIQQALADGLRNVLIIHGKGRDDKSHANIVRSYVARWLTEFDDVQAYCTALPHHGGSGACYVALR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004518 - nuclease activity
GO:0004519 - endonuclease activity
GO:0016787 - hydrolase activity
GO:0004520 - endodeoxyribonuclease activity
biological_process GO:0006259 - DNA metabolic process
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
Note(s): Note(s): ...[more].
Reference(s): [1] Blank D., et al., 2014
External database links:  
ECOCYC:
G6672-MONOMER
ECOLIWIKI:
b1340
INTERPRO:
IPR002625
INTERPRO:
IPR036063
PDB:
3QD7
PFAM:
PF01713
PRIDE:
P76053
PROSITE:
PS50828
REFSEQ:
NP_415856
SMART:
SM00463
SMR:
P76053
UNIPROT:
P76053


Operon      
Name: smrA         
Operon arrangement:
Transcription unit        Promoter
ydaL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1761 1405810 reverse nd [RS-EPT-CBR] [2]
  promoter smrAp1 1405936 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_1762 1405955 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1763 1407393 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1764 1407477 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Blank D., Wolf L., Ackermann M., Silander OK., 2014, The predictability of molecular evolution during functional innovation., Proc Natl Acad Sci U S A 111(8):3044-9

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB