RegulonDB RegulonDB 10.9: Gene Form
   

dgcM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dgcM smrA ynaN TSS_1766 TSS_1766 zntBp zntBp TSS_1765 TSS_1765 TSS_1764 TSS_1764 TSS_1763 TSS_1763

Gene      
Name: dgcM    Texpresso search in the literature
Synonym(s): ECK1338, G6673, b1341, ydaM
Genome position(nucleotides): 1406563 <-- 1407795 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.69
External database links:  
ASAP:
ABE-0004504
ECHOBASE:
EB3138
ECOLIHUB:
ydaM
OU-MICROARRAY:
b1341
STRING:
511145.b1341
COLOMBOS: dgcM


Product      
Name: diguanylate cyclase DgcM
Synonym(s): DgcM, YdaM
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 46.452
Isoelectric point: 6.825
Motif(s):
 
Type Positions Sequence
142 -> 244 MLLIDPSRDGQIVDANLAALNFYGYNHETMCQKHTWEINMLGRRVMPIMHEISHLPGGHKPLNFVHKLADGSTRHVQTYAGPIEIYGDKLMLCIVHDITEQKR
129 -> 198 GFYARFFLTNSAPMLLIDPSRDGQIVDANLAALNFYGYNHETMCQKHTWEINMLGRRVMPIMHEISHLPG
199 -> 251 GHKPLNFVHKLADGSTRHVQTYAGPIEIYGDKLMLCIVHDITEQKRLEEQLEH
283 -> 410 QDYSLLLIDTDRFKHINDLYGHSKGDEVLCALARTLESCARKGDLVFRWGGEEFVLLLPRTPLDTALSLAETIRVSVAKVSISGLPRFTVSIGVAHHEGNESIDELFKRVDDALYRAKNDGRNRVLAA
3 -> 70 THNFNTLDLLTSPVWIVSPFEEQLIYANSAAKLLMQDLTFSQLRTGPYSVSSQKELPKYLSDLQNQHD

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0005525 - GTP binding
GO:0042802 - identical protein binding
GO:0052621 - diguanylate cyclase activity
biological_process GO:0043709 - cell adhesion involved in single-species biofilm formation
GO:1902201 - negative regulation of bacterial-type flagellum-dependent cell motility
GO:0019935 - cyclic-nucleotide-mediated signaling
GO:0051091 - positive regulation of DNA-binding transcription factor activity
GO:1900233 - positive regulation of single-species biofilm formation on inanimate substrate
External database links:  
DIP:
DIP-28053N
ECOCYC:
G6673-MONOMER
ECOLIWIKI:
b1341
INTERPRO:
IPR000700
INTERPRO:
IPR000160
INTERPRO:
IPR000014
INTERPRO:
IPR013656
INTERPRO:
IPR043128
INTERPRO:
IPR035965
INTERPRO:
IPR029787
MINT:
P77302
MODBASE:
P77302
PFAM:
PF00990
PFAM:
PF08448
PRIDE:
P77302
PROSITE:
PS50113
PROSITE:
PS50887
REFSEQ:
NP_415857
SMART:
SM00267
SMART:
SM00091
SMR:
P77302
UNIPROT:
P77302


Operon      
Name: dgcM         
Operon arrangement:
Transcription unit        Promoter
ydaM


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1763 1407393 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1764 1407477 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1765 1407869 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1766 1408027 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB