RegulonDB RegulonDB 10.9: Gene Form
   

ydaT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydaU ydaT ydaS racRp4 racRp4

Gene      
Name: ydaT    Texpresso search in the literature
Synonym(s): ECK1356, G6682, b1358
Genome position(nucleotides): 1420684 --> 1421106 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.83
External database links:  
ASAP:
ABE-0004556
ECHOBASE:
EB3145
ECOLIHUB:
ydaT
OU-MICROARRAY:
b1358
STRING:
511145.b1358
COLOMBOS: ydaT


Product      
Name: Rac prophage; protein YdaT
Synonym(s): YdaT
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 15.743
Isoelectric point: 7.805
Motif(s):
 
Type Positions Sequence
49 -> 105 NNQQNIYHRWLKGETKTQREKIQKLIPAILAILPRELRHRLCIFDTLERRALLAAQE

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
biological_process GO:0043093 - FtsZ-dependent cytokinesis
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Bindal G., et al., 2017
External database links:  
DIP:
DIP-11627N
ECOCYC:
G6682-MONOMER
ECOLIWIKI:
b1358
INTERPRO:
IPR009364
INTERPRO:
IPR037042
PFAM:
PF06254
PRIDE:
P76064
REFSEQ:
NP_415876
SMR:
P76064
UNIPROT:
P76064


Operon      
Name: ydaSTUVW-rzpR         
Operon arrangement:
Transcription unit        Promoter
ydaSTUVW-rzpR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter racRp4 1420449 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Bindal G., Krishnamurthi R., Seshasayee ASN., Rath D., 2017, CRISPR-Cas-Mediated Gene Silencing Reveals RacR To Be a Negative Regulator of YdaS and YdaT Toxins in Escherichia coli K-12., mSphere 2(6)

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB