RegulonDB RegulonDB 10.9: Gene Form
   

ydaU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydaU ydaV ydaT

Gene      
Name: ydaU    Texpresso search in the literature
Synonym(s): ECK1357, G6683, b1359
Genome position(nucleotides): 1421119 --> 1421976 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.9
External database links:  
ASAP:
ABE-0004558
ECHOBASE:
EB3146
ECOLIHUB:
ydaU
ECOO157CYC:
Z2397
OU-MICROARRAY:
b1359
STRING:
511145.b1359
COLOMBOS: ydaU


Product      
Name: Rac prophage; DUF1376 domain-containing protein YdaU
Synonym(s): YdaU
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.509
Isoelectric point: 9.238
Motif(s):
 
Type Positions Sequence
22 -> 104 PYMQLYIADYLADTMHLSAEEHGAYLLLMFNYWQTGKPIPKNRLAKIARLTNERWADVEPSLQEFFCDNGEEWVHLRIEEDLA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11628N
ECOCYC:
G6683-MONOMER
ECOLIWIKI:
b1359
ECOO157CYC:
Z2397-MONOMER
INTERPRO:
IPR010781
PFAM:
PF07120
PRIDE:
P76065
REFSEQ:
NP_415877
SMR:
P76065
UNIPROT:
P76065


Operon      
Name: ydaSTUVW-rzpR         
Operon arrangement:
Transcription unit        Promoter
ydaSTUVW-rzpR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB