RegulonDB RegulonDB 10.9: Gene Form
   

ynaA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ynaA insH5 ydaY unknown ynaK terminator

Gene      
Name: ynaA    Texpresso search in the literature
Synonym(s): ECK1365, G6691, b1368, tmpR
Genome position(nucleotides): 1426454 --> 1427482 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.84
External database links:  
ASAP:
ABE-0004581
ECHOBASE:
EB3151
ECOLIHUB:
ynaA
OU-MICROARRAY:
b1368
STRING:
316407.1742228
COLOMBOS: ynaA


Product      
Name: Rac prophage; putative prophage tail length tape measure domain-containing protein YnaA
Synonym(s): TmpR, YnaA
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 37.06
Isoelectric point: 6.338
Motif(s):
 
Type Positions Sequence
267 -> 311 QLSKTGMSAKQTAFAMRMLPAQMTDIVVGLSTGQSPFMVLMQQGG

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12737N
ECOCYC:
G6691-MONOMER
ECOLIWIKI:
b1368
INTERPRO:
IPR009628
PFAM:
PF06791
PRIDE:
P77658
REFSEQ:
NP_415886
SMR:
P77658
UNIPROT:
P77658


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB