RegulonDB RegulonDB 10.9: Gene Form
   

insH5 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

stfR ynaA insH5 terminator anti-terminator anti-anti-terminator insHp3 insHp3

Gene      
Name: insH5    Texpresso search in the literature
Synonym(s): ECK0261, G6693, b1370, trs5-5, yi52_5
Genome position(nucleotides): 1427746 <-- 1428726 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.45
External database links:  
ASAP:
ABE-0004586
ECHOBASE:
EB4723
ECOLIHUB:
insH-5
OU-MICROARRAY:
b1370
STRING:
511145.b1370
COLOMBOS: insH5


Product      
Name: Rac prophage; IS5 transposase and trans-activator
Synonym(s): InsH5, Trs5-5, Yi52_5
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 37.777
Isoelectric point: 10.116
Motif(s):
 
Type Positions Sequence
51 -> 124 GRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDRTTIMNFRHLLEQHQLARQLFKT
138 -> 312 QGTLVDATIIEAPSSTKNKEQQRDPEMHQTKKGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVSADAGYQGAPQREELAEVDVDWLIAERPGKVKTLKQNPRKNKTAINIEYMKASIRARVEHPFRIIKRQFGFVKARYKGLLKNDNQLAMLFTLANL

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0032196 - transposition
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6693-MONOMER
ECOLIWIKI:
b1370
INTERPRO:
IPR002559
INTERPRO:
IPR008490
PFAM:
PF05598
PFAM:
PF01609
PRIDE:
P76071
REFSEQ:
NP_415888
UNIPROT:
P76071


Operon      
Name: insH5         
Operon arrangement:
Transcription unit        Promoter
insH-5


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter insHp3 1428926 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB