RegulonDB RegulonDB 10.9: Gene Form
   

stfR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

stfR insH5 pinR tfaR terminator anti-terminator anti-anti-terminator insHp3 insHp3

Gene      
Name: stfR    Texpresso search in the literature
Synonym(s): ECK1367, G6695, b1372, ynaB
Genome position(nucleotides): 1429049 --> 1432411 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.35
External database links:  
ASAP:
ABE-0004595
ECHOBASE:
EB3152
ECOLIHUB:
stfR
OU-MICROARRAY:
b1372
STRING:
511145.b1372
COLOMBOS: stfR


Product      
Name: Rac prophage; putative prophage side tail fiber protein StfR
Synonym(s): Rac prophage; putative membrane protein, StfR, YnaB
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space
Molecular weight: 113.78
Isoelectric point: 7.732
Motif(s):
 
Type Positions Sequence
1002 -> 1015 NNTGAHTHSVSGST
907 -> 953 GAPIPWPSDTVPSGYALMQGQAFDKSAYPKLAAAYPSGVIPDMRGWT
1079 -> 1090 GIGAHTHSVAIG
1016 -> 1025 NSAGAHTHSL
1055 -> 1068 SSAGAHTHSLSGTA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005576 - extracellular region
molecular_function GO:0005198 - structural molecule activity
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
Reference(s): [1] Riley M., et al., 2006
External database links:  
DIP:
DIP-10932N
ECOCYC:
G6695-MONOMER
ECOLIWIKI:
b1372
INTERPRO:
IPR005003
INTERPRO:
IPR008969
INTERPRO:
IPR011083
INTERPRO:
IPR013609
INTERPRO:
IPR037053
MODBASE:
P76072
PFAM:
PF08400
PFAM:
PF07484
PFAM:
PF03335
PRIDE:
P76072
PRODB:
PRO_000023999
REFSEQ:
NP_415890
SMR:
P76072
UNIPROT:
P76072


Operon      
Name: stfR-tfaR         
Operon arrangement:
Transcription unit        Promoter
stfR-tfaR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter insHp3 1428926 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Riley M., Abe T., Arnaud MB., Berlyn MK., Blattner FR., Chaudhuri RR., Glasner JD., Horiuchi T., Keseler IM., Kosuge T., Mori H., Perna NT., Plunkett G., Rudd KE., Serres MH., Thomas GH., Thomson NR., Wishart D., Wanner BL., 2006, Escherichia coli K-12: a cooperatively developed annotation snapshot--2005., Nucleic Acids Res 34(1):1-9

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB