RegulonDB RegulonDB 10.9: Gene Form
   

paaC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

paaC paaD paaB

Gene      
Name: paaC    Texpresso search in the literature
Synonym(s): ECK1387, G6711, b1390, ydbP
Genome position(nucleotides): 1455164 --> 1455910 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.01
External database links:  
ASAP:
ABE-0004653
ECHOBASE:
EB3500
ECOLIHUB:
paaC
OU-MICROARRAY:
b1390
STRING:
511145.b1390
COLOMBOS: paaC


Product      
Name: phenylacetyl-CoA 1,2-epoxidase, structural subunit
Synonym(s): PaaC, YdbP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.877
Isoelectric point: 4.635
Motif(s):
 
Type Positions Sequence
2 -> 248 NQLTAYTLRLGDNCLVLSQRLGEWCGHAPELEIDLALANIGLDLLGQARNFLSYAAELAGEGDEDTLAFTRDERQFSNLLLVEQPNGNFADTIARQYFIDAWHVALFTRLMESRDPQLAAISAKAIKEARYHLRFSRGWLERLGNGTDVSGQKMQQAINKLWRFTAELFDADEIDIALSEEGIAVDPRTLRAAWEAEVFAGINEATLNVPQEQAYRTGGKKGLHTEHLGPMLAEMQYLQRVLPGQQW
160 -> 160 N
76 -> 79 QFSN
177 -> 179 IAL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
biological_process GO:0010124 - phenylacetate catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6711-MONOMER
ECOLIWIKI:
b1390
INTERPRO:
IPR011882
INTERPRO:
IPR009078
INTERPRO:
IPR007814
INTERPRO:
IPR012347
MODBASE:
P76079
PDB:
4II4
PDB:
3PWQ
PDB:
3PW8
PDB:
3PW1
PDB:
3PVY
PDB:
3PVT
PDB:
3PVR
PDB:
1OTK
PFAM:
PF05138
PRIDE:
P76079
PRODB:
PRO_000023477
REFSEQ:
NP_415908
SMR:
P76079
UNIPROT:
P76079


Operon      
Name: paaABCDEFGHIJK         
Operon arrangement:
Transcription unit        Promoter
paaABCDEFGHIJK
paaJ
paaJ
paaJ


Transcriptional Regulation      
Display Regulation             
Activated by: SlyA, CRP, IHF
Repressed by: PaaX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB