RegulonDB RegulonDB 11.0: Gene Form
   

paaE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

paaE paaG paaF paaD

Gene      
Name: paaE    Texpresso search in the literature
Synonym(s): ECK1389, G6713, b1392, ydbR
Genome position(nucleotides): 1456430 --> 1457500
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.31
External database links:  
ASAP:
ABE-0004657
ECHOBASE:
EB3502
ECOLIHUB:
paaE
OU-MICROARRAY:
b1392
STRING:
511145.b1392
COLOMBOS: paaE


Product      
Name: phenylacetyl-CoA 1,2-epoxidase, reductase subunit
Synonym(s): PaaE, YdbR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.32
Isoelectric point: 6.262
Motif(s):
 
Type Positions Sequence Comment
2 -> 106 TTFHSLTVAKVESETRDAVTITFAVPQPLQEAYRFRPGQHLTLKASFDGEELRRCYSICRSYLPGEISVAVKAIEGGRFSRYAREHIRQGMTLEVMVPQGHFGYQ UniProt: FAD-binding FR-type.
7 -> 105 LTVAKVESETRDAVTITFAVPQPLQEAYRFRPGQHLTLKASFDGEELRRCYSICRSYLPGEISVAVKAIEGGRFSRYAREHIRQGMTLEVMVPQGHFGY
14 -> 14 S UniProt: In strain: W..
112 -> 228 QGRYLAIAAGSGITPMLAIIATTLQTEPESQFTLIYGNRTSQSMMFRQALADLKDKYPQRLQLLCIFSQETLDSDLLHGRIDGEKLQSLGASLINFRLYDEAFICGPAAMMDDAETA UniProt: Oxidoreductase; Sequence Annotation Type: region of interest.
118 -> 226 IAAGSGITPMLAIIATTLQTEPESQFTLIYGNRTSQSMMFRQALADLKDKYPQRLQLLCIFSQETLDSDLLHGRIDGEKLQSLGASLINFRLYDEAFICGPAAMMDDAE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0062077 - phenylacetyl-CoA 1,2-epoxidase complex
GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0050660 - flavin adenine dinucleotide binding
GO:0051536 - iron-sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
biological_process GO:0010124 - phenylacetate catabolic process
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P76081
ECOCYC:
G6713-MONOMER
ECOLIWIKI:
b1392
INTERPRO:
IPR008333
INTERPRO:
IPR012675
INTERPRO:
IPR011884
INTERPRO:
IPR006058
INTERPRO:
IPR001709
INTERPRO:
IPR001433
INTERPRO:
IPR001041
INTERPRO:
IPR017938
INTERPRO:
IPR017927
INTERPRO:
IPR039261
INTERPRO:
IPR036010
MODBASE:
P76081
PFAM:
PF00970
PFAM:
PF00175
PFAM:
PF00111
PRIDE:
P76081
PRINTS:
PR00371
PROSITE:
PS51384
PROSITE:
PS51085
PROSITE:
PS00197
REFSEQ:
NP_415910
SWISSMODEL:
P76081
UNIPROT:
P76081


Operon      
Name: paaABCDEFGHIJK         
Operon arrangement:
Transcription unit        Promoter
paaABCDEFGHIJK
paaJ
paaJ
paaJ


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, SlyA, IHF
Repressed by: PaaX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB