RegulonDB RegulonDB 10.8: Gene Form
   

paaH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

paaH paaJ paaG paaI paaJp paaJp paaJp2 paaJp2 paaJp3 paaJp3

Gene      
Name: paaH    Texpresso search in the literature
Synonym(s): ECK1392, G6716, b1395, hbdH, ydbU
Genome position(nucleotides): 1459054 --> 1460481 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.22
External database links:  
ASAP:
ABE-0004663
ECHOBASE:
EB3505
MIM:
231530
MIM:
609975
OU-MICROARRAY:
b1395
PortEco:
paaH
STRING:
511145.b1395
COLOMBOS: paaH


Product      
Name: 3-hydroxyadipyl-CoA dehydrogenase
Synonym(s): 3-hydroxyadipyl-CoA dehydrogenase (NAD+), HbdH, PaaH, YdbU
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 51.733
Isoelectric point: 5.715
Motif(s):
 
Type Positions Sequence
132 -> 132 I
387 -> 466 GMLIWRTVAMIINEALDALQKGVASEQDIDTAMRLGVNYPYGPLAWGAQLGWQRILRLLENLQHHYGEERYRPCSLLRQR
324 -> 386 ETQGETAQALAIRLARPVVVIDKMAGKVVTIAAAAVNPDSATRKAIYYLQQQGKTVLQIADYP
7 -> 184 TVAVIGSGTMGAGIAEVAASHGHQVLLYDISAEALTRAIDGIHARLNSRVTRGKLTAETCERTLKRLIPVTDIHALAAADLVIEAASERLEVKKALFAQLAEVCPPQTLLTTNTSSISITAIAAEIKNPERVAGLHFFNPAPVMKLVEVVSGLATAAEVVEQLCELTLSWGKQPVRCH
188 -> 285 GFIVNRVARPYYSEAWRALEEQVAAPEVIDAALRDGAGFPMGPLELTDLIGQDVNFAVTCSVFNAFWQERRFLPSLVQQELVIGGRLGKKSGLGVYDW

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
molecular_function GO:0016491 - oxidoreductase activity
GO:0003857 - 3-hydroxyacyl-CoA dehydrogenase activity
GO:0008691 - 3-hydroxybutyryl-CoA dehydrogenase activity
biological_process GO:0006631 - fatty acid metabolic process
GO:0010124 - phenylacetate catabolic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Park SJ., et al., 2004
External database links:  
ECOCYC:
G6716-MONOMER
ECOLIWIKI:
b1395
INTERPRO:
IPR041040
INTERPRO:
IPR036291
INTERPRO:
IPR011967
INTERPRO:
IPR008927
INTERPRO:
IPR006108
INTERPRO:
IPR006176
INTERPRO:
IPR006180
MODBASE:
P76083
PDB:
3MOG
PFAM:
PF00725
PFAM:
PF18321
PFAM:
PF02737
PRIDE:
P76083
PROSITE:
PS00067
REFSEQ:
NP_415913
SMR:
P76083
UNIPROT:
P76083


Operon      
Name: paaABCDEFGHIJK         
Operon arrangement:
Transcription unit        Promoter
paaABCDEFGHIJK
paaJ
paaJ
paaJ


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, SlyA, IHF
Repressed by: PaaX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Park SJ., Yup Lee S., 2004, New FadB homologous enzymes and their use in enhanced biosynthesis of medium-chain-length polyhydroxyalkanoates in FadB mutant Escherichia coli., Biotechnol Bioeng 86(6):681-6


RegulonDB