RegulonDB RegulonDB 10.8: Gene Form
   

paaI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

paaH paaK paaJ paaG paaI paaJp paaJp paaJp2 paaJp2 paaJp3 paaJp3

Gene      
Name: paaI    Texpresso search in the literature
Synonym(s): ECK1393, G6717, b1396, ydbV
Genome position(nucleotides): 1460471 --> 1460893 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.54
External database links:  
ASAP:
ABE-0004666
ECHOBASE:
EB3506
OU-MICROARRAY:
b1396
PortEco:
paaI
STRING:
511145.b1396
COLOMBOS: paaI


Product      
Name: phenylacetyl-CoA thioesterase
Synonym(s): PaaI, YdbV
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 14.851
Isoelectric point: 6.781
Motif(s):
 
Type Positions Sequence
46 -> 46 N
49 -> 123 QSCHGGQLFSLADTAFAYACNSQGLAAVASACTIDFLRPGFAGDTLTATAQVRHQGKQTGVYDIEIVNQQQKTVA
2 -> 140 SHKAWQNAHAMYENDACAKALGIDIISMDEGFAVVTMTVTAQMLNGHQSCHGGQLFSLADTAFAYACNSQGLAAVASACTIDFLRPGFAGDTLTATAQVRHQGKQTGVYDIEIVNQQQKTVALFRGKSHRIGGTITGEA
52 -> 52 H
61 -> 61 D

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0016790 - thiolester hydrolase activity
GO:0016289 - CoA hydrolase activity
biological_process GO:0010124 - phenylacetate catabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10428N
ECOCYC:
G6717-MONOMER
ECOLIWIKI:
b1396
INTERPRO:
IPR006683
INTERPRO:
IPR029069
INTERPRO:
IPR011973
INTERPRO:
IPR003736
MODBASE:
P76084
PDB:
1PSU
PDB:
2FS2
PFAM:
PF03061
PRIDE:
P76084
PRODB:
PRO_000023479
REFSEQ:
NP_415914
SMR:
P76084
UNIPROT:
P76084


Operon      
Name: paaABCDEFGHIJK         
Operon arrangement:
Transcription unit        Promoter
paaABCDEFGHIJK
paaJ
paaJ
paaJ


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, SlyA, IHF
Repressed by: PaaX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB