RegulonDB RegulonDB 10.8: Gene Form
   

paaJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

paaH paaK paaJ paaI paaJp paaJp paaJp2 paaJp2 paaJp3 paaJp3

Gene      
Name: paaJ    Texpresso search in the literature
Synonym(s): ECK1394, G6718, b1397, ydbW
Genome position(nucleotides): 1460893 --> 1462098 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.97
External database links:  
ASAP:
ABE-0004668
ECHOBASE:
EB3507
OU-MICROARRAY:
b1397
PortEco:
paaJ
STRING:
511145.b1397
COLOMBOS: paaJ


Product      
Name: β-ketoadipyl-CoA thiolase
Synonym(s): PaaJ, YdbW
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 42.277
Isoelectric point: 6.402
Motif(s):
 
Type Positions Sequence
277 -> 400 TPRARIVAMATAGVEPRLMGLGPVPATRRVLERAGLSIHDMDVIELNEAFAAQALGVLRELGLPDDAPHVNPNGGAIALGHPLGMSGARLALAASHELHRRNGRYALCTMCIGVGQGIAMILER
5 -> 269 FICDGIRTPIGRYGGALSSVRADDLAAIPLRELLVRNPRLDAECIDDVILGCANQAGEDNRNVARMATLLAGLPQSVSGTTINRLCGSGLDALGFAARAIKAGDGDLLIAGGVESMSRAPFVMGKAASAFSRQAEMFDTTIGWRFVNPLMAQQFGTDSMPETAENVAELLKISREDQDSFALRSQQRTAKAQSSGILAEEIVPVVLKNKKGVVTEIQHDEHLRPETTLEQLRGLKAPFRANGVITAGNASGVNDGAAALIIASEQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0016747 - transferase activity, transferring acyl groups other than amino-acyl groups
GO:0003988 - acetyl-CoA C-acyltransferase activity
GO:0033812 - 3-oxoadipyl-CoA thiolase activity
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0010124 - phenylacetate catabolic process
GO:0006635 - fatty acid beta-oxidation
GO:0019619 - 3,4-dihydroxybenzoate catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6718-MONOMER
ECOLIWIKI:
b1397
INTERPRO:
IPR002155
INTERPRO:
IPR020616
INTERPRO:
IPR020615
INTERPRO:
IPR020613
INTERPRO:
IPR020610
INTERPRO:
IPR020617
INTERPRO:
IPR012793
INTERPRO:
IPR016039
MODBASE:
P77525
PANTHER:
PTHR18919
PFAM:
PF00108
PFAM:
PF02803
PRIDE:
P0C7L2
PROSITE:
PS00099
PROSITE:
PS00737
PROSITE:
PS00098
REFSEQ:
NP_415915
SMR:
P0C7L2
SWISSMODEL:
P77525
UNIPROT:
P0C7L2


Operon      
Name: paaABCDEFGHIJK         
Operon arrangement:
Transcription unit        Promoter
paaABCDEFGHIJK
paaJ
paaJ
paaJ


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, SlyA, IHF
Repressed by: PaaX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB