RegulonDB RegulonDB 10.9: Gene Form
   

paaK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

paaK paaJ paaX paaY PaaX TSS_1790 TSS_1790 paaXp paaXp

Gene      
Name: paaK    Texpresso search in the literature
Synonym(s): ECK1395, G6719, b1398
Genome position(nucleotides): 1462125 --> 1463438 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.83
External database links:  
ASAP:
ABE-0004671
ECHOBASE:
EB3508
ECOLIHUB:
paaK
OU-MICROARRAY:
b1398
STRING:
511145.b1398
COLOMBOS: paaK


Product      
Name: phenylacetate-CoA ligase
Synonym(s): PaaK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 48.953
Isoelectric point: 6.634
Motif(s):
 
Type Positions Sequence
78 -> 289 DTFAVPMEQVVRIHASSGTTGKPTVVGYTQNDIDNWANIVARSLRAAGGSPKDKIHVAYGYGLFTGGLGAHYGAERLGATVIPMSGGQTEKQAQLIRDFQPDMIMVTPSYCLNLIEELERQLGGDASGCSLRVGVFGAEPWTQAMRKEIERRLGITALDIYGLSEVMGPGVAMECLETTDGPTIWEDHFYPEIVNPHDGTPLADGEHGELLF
336 -> 432 GVNVFPSQLEEEIVKFEHLSPHYQLEVNRRGHLDSLSVKVELKESSLTLTHEQRCQVCHQLRHRIKSMVGISTDVMIVNCGSIPRSEGKACRVFDLR
127 -> 127 S

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016874 - ligase activity
GO:0016405 - CoA-ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0047475 - phenylacetate-CoA ligase activity
biological_process GO:0010124 - phenylacetate catabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Vitovski S. 1993
External database links:  
DIP:
DIP-10430N
ECOCYC:
G6719-MONOMER
ECOLIWIKI:
b1398
INTERPRO:
IPR000873
INTERPRO:
IPR011880
INTERPRO:
IPR028154
INTERPRO:
IPR042099
MODBASE:
P76085
PFAM:
PF14535
PFAM:
PF00501
PRIDE:
P76085
PRODB:
PRO_000023481
REFSEQ:
NP_415916
SMR:
P76085
UNIPROT:
P76085


Operon      
Name: paaABCDEFGHIJK         
Operon arrangement:
Transcription unit        Promoter
paaABCDEFGHIJK
paaJ
paaJ
paaJ


Transcriptional Regulation      
Display Regulation             
Activated by: SlyA, CRP, IHF
Repressed by: PaaX


Regulation by small RNA    
  Display Regulation
small RNA spf


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1790 1463510 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Vitovski S., 1993, Phenylacetate-coenzyme A ligase is induced during growth on phenylacetic acid in different bacteria of several genera., FEMS Microbiol Lett 108(1):1-5

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB