RegulonDB RegulonDB 10.8: Gene Form
   

paaK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

paaK paaJ paaX paaY PaaX TSS_1790 TSS_1790 paaXp paaXp

Gene      
Name: paaK    Texpresso search in the literature
Synonym(s): ECK1395, G6719, b1398
Genome position(nucleotides): 1462125 --> 1463438 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.83
External database links:  
ASAP:
ABE-0004671
ECHOBASE:
EB3508
OU-MICROARRAY:
b1398
PortEco:
paaK
STRING:
511145.b1398
COLOMBOS: paaK


Product      
Name: phenylacetate-CoA ligase
Synonym(s): PaaK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 48.953
Isoelectric point: 6.634
Motif(s):
 
Type Positions Sequence
78 -> 289 DTFAVPMEQVVRIHASSGTTGKPTVVGYTQNDIDNWANIVARSLRAAGGSPKDKIHVAYGYGLFTGGLGAHYGAERLGATVIPMSGGQTEKQAQLIRDFQPDMIMVTPSYCLNLIEELERQLGGDASGCSLRVGVFGAEPWTQAMRKEIERRLGITALDIYGLSEVMGPGVAMECLETTDGPTIWEDHFYPEIVNPHDGTPLADGEHGELLF
336 -> 432 GVNVFPSQLEEEIVKFEHLSPHYQLEVNRRGHLDSLSVKVELKESSLTLTHEQRCQVCHQLRHRIKSMVGISTDVMIVNCGSIPRSEGKACRVFDLR
127 -> 127 S

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016874 - ligase activity
GO:0016405 - CoA-ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0047475 - phenylacetate-CoA ligase activity
biological_process GO:0010124 - phenylacetate catabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Vitovski S. 1993
External database links:  
DIP:
DIP-10430N
ECOCYC:
G6719-MONOMER
ECOLIWIKI:
b1398
INTERPRO:
IPR028154
INTERPRO:
IPR042099
INTERPRO:
IPR011880
INTERPRO:
IPR000873
MODBASE:
P76085
PFAM:
PF14535
PFAM:
PF00501
PRIDE:
P76085
PRODB:
PRO_000023481
REFSEQ:
NP_415916
SMR:
P76085
UNIPROT:
P76085


Operon      
Name: paaABCDEFGHIJK         
Operon arrangement:
Transcription unit        Promoter
paaABCDEFGHIJK
paaJ
paaJ
paaJ


Transcriptional Regulation      
Display Regulation             
Activated by: SlyA, CRP, IHF
Repressed by: PaaX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1790 1463510 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Vitovski S., 1993, Phenylacetate-coenzyme A ligase is induced during growth on phenylacetic acid in different bacteria of several genera., FEMS Microbiol Lett 108(1):1-5

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB