RegulonDB RegulonDB 10.8: Gene Form
   

paaX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

paaK paaX paaY ynbG PaaX TSS_1790 TSS_1790 paaXp paaXp

Gene      
Name: paaX    Texpresso search in the literature
Synonym(s): ECK1396, G6720, b1399, ydbY
Genome position(nucleotides): 1463539 --> 1464489 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.37
Reference(s): [1] Ferrandez A., et al., 1998
External database links:  
ASAP:
ABE-0004674
ECHOBASE:
EB3509
OU-MICROARRAY:
b1399
PortEco:
paaX
STRING:
511145.b1399
COLOMBOS: paaX


Product      
Name: DNA-binding transcriptional repressor PaaX
Synonym(s): PaaX, YdbY
Sequence: Get amino acid sequence Fasta Format
Regulator Family: PaaX
Cellular location: cytosol
Molecular weight: 35.295
Isoelectric point: 7.614
Motif(s):
 
Type Positions Sequence
315 -> 315 I
5 -> 5 D
19 -> 87 GTSLISSLYGDSLSHRGGEIWLGSLAALLEGLGFGERFVRTALFRLNKEGWLDVSRIGRRSFYSLSDKG
183 -> 280 RARVEECWHLTEQNAMYETFIQSFRPLVPLLKEAADELTPERAFHIQLLLIHFYRRVVLKDPLLPEELLPAHWAGHTARQLCINIYQRVAPAALAFVS
311 -> 311 L

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0000984 - bacterial-type RNA polymerase regulatory region sequence-specific DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0010124 - phenylacetate catabolic process
GO:2000143 - negative regulation of DNA-templated transcription, initiation
Reference(s): [2] Ferrandez A., et al., 2000
[3] Leonhartsberger S., et al., 2001
External database links:  
DIP:
DIP-10431N
ECOCYC:
G6720-MONOMER
ECOLIWIKI:
b1399
INTERPRO:
IPR012906
INTERPRO:
IPR036388
INTERPRO:
IPR013225
INTERPRO:
IPR011965
PFAM:
PF08223
PFAM:
PF07848
PRIDE:
P76086
PRODB:
PRO_000023482
REFSEQ:
NP_415917
SMR:
P76086
UNIPROT:
P76086


Operon      
Name: paaXY         
Operon arrangement:
Transcription unit        Promoter
paaXY


Transcriptional Regulation      
Display Regulation             
Repressed by: PaaX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1790 1463510 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Ferrandez A., Minambres B., Garcia B., Olivera ER., Luengo JM., Garcia JL., Diaz E., 1998, Catabolism of phenylacetic acid in Escherichia coli. Characterization of a new aerobic hybrid pathway., J Biol Chem 273(40):25974-86

 [2] Ferrandez A., Garcia JL., Diaz E., 2000, Transcriptional regulation of the divergent paa catabolic operons for phenylacetic acid degradation in Escherichia coli., J Biol Chem 275(16):12214-22

 [3] Leonhartsberger S., Huber A., Lottspeich F., Bock A., 2001, The hydH/G Genes from Escherichia coli code for a zinc and lead responsive two-component regulatory system., J Mol Biol 307(1):93-105

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB