RegulonDB RegulonDB 10.9: Gene Form
   

paaY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

paaK paaX paaY ynbG PaaX TSS_1790 TSS_1790 paaXp paaXp

Gene      
Name: paaY    Texpresso search in the literature
Synonym(s): ECK1397, G6721, b1400, ydbZ
Genome position(nucleotides): 1464471 --> 1465061 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.59
External database links:  
ASAP:
ABE-0004676
ECHOBASE:
EB3510
ECOLIHUB:
paaY
OU-MICROARRAY:
b1400
STRING:
511145.b1400
COLOMBOS: paaY


Product      
Name: 2-hydroxycyclohepta-1,4,6-triene-1-carboxyl-CoA thioesterase
Synonym(s): PaaY, YdbZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.325
Isoelectric point: 6.62
Motif(s):
 
Type Positions Sequence
15 -> 45 EESFVHPTAVLIGDVILGKGVYVGPNASLRG
179 -> 179 I
182 -> 182 G
88 -> 122 GCIIRRNALVGMNAVVMDGAVIGENSIVGASAFVK
75 -> 75 G

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016289 - CoA hydrolase activity
biological_process GO:0010124 - phenylacetate catabolic process
External database links:  
ECOCYC:
G6721-MONOMER
ECOLIWIKI:
b1400
INTERPRO:
IPR011974
INTERPRO:
IPR011004
INTERPRO:
IPR001451
MODBASE:
P77181
PFAM:
PF00132
PRIDE:
P77181
PRODB:
PRO_000023483
REFSEQ:
NP_415918
SMR:
P77181
UNIPROT:
P77181


Operon      
Name: paaXY         
Operon arrangement:
Transcription unit        Promoter
paaXY


Transcriptional Regulation      
Display Regulation             
Repressed by: PaaX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1790 1463510 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB