RegulonDB RegulonDB 11.0: Gene Form
   

ydbA gene in Escherichia coli K-12 genome

Gene      
Name: ydbA    Texpresso search in the literature
Synonym(s): ECK1398, G6722, b1401, b1405, b4492
Type: Pseudo Gene
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.58
External database links:  
ASAP:
ABE-0004680
ASAP:
ABE-0004694
ASAP:
ABE-0285093
ECOLIHUB:
ydbA_1
ECOLIHUB:
ydbA_2
OU-MICROARRAY:
b1401
OU-MICROARRAY:
b1405
COLOMBOS: ydbA


Product      
Name: putative outer membrane protein, N-terminal fragment
Sequence: Get amino acid sequence Fasta Format
Isoelectric point: 5.41
Motif(s):
 
Type Positions Sequence Comment
1 -> 21 MQRKTLLSACIALALSGQGWA
22 -> 852 ADITEVETTTGEKKNTNVTCPADPGKLSPEELKRLPSECSPLVEQNLMPWLSTGAAALITALAVVELNDDDDHHHRNNSPLPPTPPDDESDDTPVPPTPGGDEIIPDDPDDTPTPPKPVSFNNDVILDKTEKTLTIRDSVFTYTENADGTISLQDSNGRKATINLWQIDEANNTVALEGVSADGATKWQYNHNGELVITGDNATVNNNGKTTVDGKDSTGTEINGNNGKVIQDGDLDVSGGGHGIDITGDSATVDNKGTMTVTDPESMGIQIDGDKAIVNNEGESTITNGGTGTQINGDDATANNNGKTTVDGKDSTGTEINGNNGKVIQDGDLDVSGGGHGIDITGDSATVDNKGTMTVTDPESIGIQVDGDQAVVNNEGESAITNGGTGTQINGDDATANNNGKTTVDGKDSTGTEIAGNNGKVIQDGDLDVSGGGHGIDITGDSATVDNKGTMTVTDPESIGIQIDGDQAIVNNEGESTITNGGTGTQINGNDATANNSGKTTVDGKDSTGTKIAGNIGIVNLDGSLTVTGGAHGVENIGDNGTVNNKGDIVVSDTGSIGVLINGEGATVSNTGDVNVSNEATGFSITTNSGKVSLAGSMQVGDFSTGVDLNGNNNSVTLAAKDLKVVGQKATGINVSGDANTVNITGNVLVDKDKTADNAAEYFFDPSVGINVYGSDNNVTLDGKLTVVSDSEVTSRQSNLFDGSAEKTSGLVVIGDGNTVNMNGGLELIGEKNALADGSQVTSLRTGYSYTSVIVVSGESSVYLNGDTTISGEFPLGFAGVIRVQDKALLEIGSGATLTMQDIDSFEHHGTRTLDLPLYFQTSVIT UniProt: Putative exported protein YdbA.
101 -> 139 PLPPTPPDDESDDTPVPPTPGGDEIIPDDPDDTPTPPKP UniProt: Pro-rich; Sequence Annotation Type: compositionally biased region.
236 -> 591 GKDSTGTEINGNNGKVIQDGDLDVSGGGHGIDITGDSATVDNKGTMTVTDPESMGIQIDGDKAIVNNEGESTITNGGTGTQINGDDATANNNGKTTVDGKDSTGTEINGNNGKVIQDGDLDVSGGGHGIDITGDSATVDNKGTMTVTDPESIGIQVDGDQAVVNNEGESAITNGGTGTQINGDDATANNNGKTTVDGKDSTGTEIAGNNGKVIQDGDLDVSGGGHGIDITGDSATVDNKGTMTVTDPESIGIQIDGDQAIVNNEGESTITNGGTGTQINGNDATANNSGKTTVDGKDSTGTKIAGNIGIVNLDGSLTVTGGAHGVENIGDNGTVNNKGDIVVSDTGSIGVLINGEG UniProt: Gly-rich; Sequence Annotation Type: compositionally biased region.

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P33666
DIP:
DIP-11631N
ECOCYC:
G6722-MONOMER
ECOLIWIKI:
b1401
INTERPRO:
IPR005546
PRIDE:
P33666
PROSITE:
PS51208
SMART:
SM00869
SMR:
P33666
UNIPROT:
P33666


Operon      
Name: ydbA         
Operon arrangement:
Transcription unit        Promoter
ydbA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB