RegulonDB RegulonDB 10.9: Gene Form
   

ydbA gene in Escherichia coli K-12 genome

Gene      
Name: ydbA    Texpresso search in the literature
Synonym(s): ECK1398, G6722, b1401, b1405, b4492
Type: Pseudo Gene
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.58
Note(s): Comment from EcoGene: Two independent insertions, IS30C and IS2D, interrupt ydbA. The IS2D insertion is in codon 839 and made a 5 bp target site duplication AACCC. The IS30C insertion is in codon 856 and made a 2 bp target site duplication CT. The pre-insertion YdbA sequence has been reconstructed and is consistent with the sequence of a closely-related E. coli 53638 protein with this region intact (NCBI gi 75515008). The first 21 aa of YdbA are predicted to be a type I signal peptide. The 17 codons between the two insertions encode PELTYADSGAKIVNKGT and were overlooked in previous reconstructions.
External database links:  
ASAP:
ABE-0004694
ASAP:
ABE-0285093
ASAP:
ABE-0004680
ECOLIHUB:
ydbA_2
ECOLIHUB:
ydbA_1
OU-MICROARRAY:
b1405
OU-MICROARRAY:
b1401
COLOMBOS: ydbA


Product      
Name: putative outer membrane protein, N-terminal fragment
Sequence: Get amino acid sequence Fasta Format
Isoelectric point: 4.075
Motif(s):
 
Type Positions Sequence
22 -> 852 ADITEVETTTGEKKNTNVTCPADPGKLSPEELKRLPSECSPLVEQNLMPWLSTGAAALITALAVVELNDDDDHHHRNNSPLPPTPPDDESDDTPVPPTPGGDEIIPDDPDDTPTPPKPVSFNNDVILDKTEKTLTIRDSVFTYTENADGTISLQDSNGRKATINLWQIDEANNTVALEGVSADGATKWQYNHNGELVITGDNATVNNNGKTTVDGKDSTGTEINGNNGKVIQDGDLDVSGGGHGIDITGDSATVDNKGTMTVTDPESMGIQIDGDKAIVNNEGESTITNGGTGTQINGDDATANNNGKTTVDGKDSTGTEINGNNGKVIQDGDLDVSGGGHGIDITGDSATVDNKGTMTVTDPESIGIQVDGDQAVVNNEGESAITNGGTGTQINGDDATANNNGKTTVDGKDSTGTEIAGNNGKVIQDGDLDVSGGGHGIDITGDSATVDNKGTMTVTDPESIGIQIDGDQAIVNNEGESTITNGGTGTQINGNDATANNSGKTTVDGKDSTGTKIAGNIGIVNLDGSLTVTGGAHGVENIGDNGTVNNKGDIVVSDTGSIGVLINGEGATVSNTGDVNVSNEATGFSITTNSGKVSLAGSMQVGDFSTGVDLNGNNNSVTLAAKDLKVVGQKATGINVSGDANTVNITGNVLVDKDKTADNAAEYFFDPSVGINVYGSDNNVTLDGKLTVVSDSEVTSRQSNLFDGSAEKTSGLVVIGDGNTVNMNGGLELIGEKNALADGSQVTSLRTGYSYTSVIVVSGESSVYLNGDTTISGEFPLGFAGVIRVQDKALLEIGSGATLTMQDIDSFEHHGTRTPELTYADSGAKIV
236 -> 591 GKDSTGTEINGNNGKVIQDGDLDVSGGGHGIDITGDSATVDNKGTMTVTDPESMGIQIDGDKAIVNNEGESTITNGGTGTQINGDDATANNNGKTTVDGKDSTGTEINGNNGKVIQDGDLDVSGGGHGIDITGDSATVDNKGTMTVTDPESIGIQVDGDQAVVNNEGESAITNGGTGTQINGDDATANNNGKTTVDGKDSTGTEIAGNNGKVIQDGDLDVSGGGHGIDITGDSATVDNKGTMTVTDPESIGIQIDGDQAIVNNEGESTITNGGTGTQINGNDATANNSGKTTVDGKDSTGTKIAGNIGIVNLDGSLTVTGGAHGVENIGDNGTVNNKGDIVVSDTGSIGVLINGEG
1 -> 21 MQRKTLLSACIALALSGQGWA
101 -> 139 PLPPTPPDDESDDTPVPPTPGGDEIIPDDPDDTPTPPKP

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11631N
ECOCYC:
G6722-MONOMER
ECOLIWIKI:
b1401
INTERPRO:
IPR005546
PRIDE:
P33666
PROSITE:
PS51208
SMART:
SM00869
SMR:
P33666
UNIPROT:
P33666


Operon      
Name: ydbA         
Operon arrangement:
Transcription unit        Promoter
ydbA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB