RegulonDB RegulonDB 10.9: Gene Form
   

insD2 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insCD2 insI2 insD2 insC2 ynbG TSS_1795 TSS_1795 TSS_1794 TSS_1794 TSS_1793 (cluster) TSS_1793 (cluster) TSS_1792 TSS_1792 TSS_1791 TSS_1791

Gene      
Name: insD2    Texpresso search in the literature
Synonym(s): ECK0358, G6723, b1402, yi22-2
Genome position(nucleotides): 1467921 <-- 1468826 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.08
External database links:  
ASAP:
ABE-0004683
ECOLIHUB:
insD-2
ECOO157CYC:
Z0322
OU-MICROARRAY:
b1402
COLOMBOS: insD2


Product      
Name: IS2 insertion element protein InsB
Synonym(s): InsD2
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 34.398
Isoelectric point: 9.121
Motif(s):
 
Type Positions Sequence
106 -> 289 KPAVPPSKRAHTGRVAVKESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFNSETVQDVMLGAVERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSPESNGIAESFVKTIKRDYISIMPKPDGLTAAKNLAEAFEHYNEWHPHSALGYRSPREYLRQRA
61 -> 104 GELPTYGYRRVWALLRRQAELDGMPAINAKRVYRIMRQNALLLE
124 -> 227 ESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFNSETVQDVMLGAVERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSP

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
biological_process GO:0006310 - DNA recombination
GO:0032196 - transposition
GO:0015074 - DNA integration
External database links:  
ECOCYC:
MONOMER0-4444
INTERPRO:
IPR001584
INTERPRO:
IPR012337
INTERPRO:
IPR025948
INTERPRO:
IPR036397
PFAM:
PF13276
PFAM:
PF00665
PRIDE:
P0CF54
PROSITE:
PS50994
REFSEQ:
NP_415920
UNIPROT:
P0CF54


Operon      
Name: insCD2C2D2         
Operon arrangement:
Transcription unit        Promoter
insC2D2CD2


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1791 1467640 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1792 1467869 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1793 (cluster) 1469178 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1794 1469343 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1795 1470141 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB