RegulonDB RegulonDB 10.9: Gene Form
   

insC2 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insCD2 insI2 insD2 insC2 TSS_1795 TSS_1795 TSS_1794 TSS_1794 TSS_1793 (cluster) TSS_1793 (cluster)

Gene      
Name: insC2    Texpresso search in the literature
Synonym(s): ECK0357, G6724, b1403, yi21-2
Genome position(nucleotides): 1468784 <-- 1469149 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.01
External database links:  
ASAP:
ABE-0004685
ECOLIHUB:
insC-2
ECOO157CYC:
Z1826
ECOO157CYC:
Z5096
ECOO157CYC:
Z4315
ECOO157CYC:
Z0365
ECOO157CYC:
Z1927
ECOO157CYC:
Z3154
OU-MICROARRAY:
b1403
STRING:
511145.b4272
COLOMBOS: insC2


Product      
Name: IS2 insertion element repressor InsA
Synonym(s): InsC2
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.452
Isoelectric point: 10.175
Motif(s):
 
Type Positions Sequence
8 -> 87 EKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAASQLFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLL

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
External database links:  
ECOCYC:
MONOMER0-4250
ECOLIWIKI:
b1403
INTERPRO:
IPR002514
INTERPRO:
IPR009057
PFAM:
PF01527
PRIDE:
P0CF41
REFSEQ:
NP_415921
UNIPROT:
P0CF41


Operon      
Name: insCD2C2D2         
Operon arrangement:
Transcription unit        Promoter
insC2D2CD2


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1791 1467640 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1792 1467869 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1793 (cluster) 1469178 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1794 1469343 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1795 1470141 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB