RegulonDB RegulonDB 10.9: Gene Form
   

azoR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hrpA ynbD azoR anti-terminator terminator terminator azoRp8 azoRp8 azoRp6 azoRp6 azoRp azoRp azoRp1 azoRp1 TSS_1800 TSS_1800

Gene      
Name: azoR    Texpresso search in the literature
Synonym(s): ECK1405, G6731, acpD, b1412
Genome position(nucleotides): 1482255 <-- 1482860 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.98
External database links:  
ASAP:
ABE-0004712
ECHOBASE:
EB2558
ECOLIHUB:
azoR
OU-MICROARRAY:
b1412
STRING:
511145.b1412
COLOMBOS: azoR


Product      
Name: FMN dependent NADH:quinone oxidoreductase
Synonym(s): AcpD, AzoR, FMN dependent azoreductase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.658
Isoelectric point: 4.838
Motif(s):
 
Type Positions Sequence
23 -> 35 DYFVEQWREKHSA
96 -> 99 MYNF
2 -> 201 SKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALRPSDAPLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVSA
16 -> 18 SQS
3 -> 195 KVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALRPSDAPLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0009055 - electron transfer activity
GO:0016491 - oxidoreductase activity
GO:0016655 - oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
GO:0016652 - oxidoreductase activity, acting on NAD(P)H, NAD(P) as acceptor
GO:0016661 - oxidoreductase activity, acting on other nitrogenous compounds as donors
GO:0010181 - FMN binding
GO:0042803 - protein homodimerization activity
GO:0050446 - azobenzene reductase activity
biological_process GO:0006979 - response to oxidative stress
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Bafana A., et al., 2008
[2] Cui D., et al., 2015
[3] Ito K., et al., 2005
[4] Kelley KD., et al., 2010
External database links:  
ECOCYC:
G6731-MONOMER
ECOLIWIKI:
B1412
INTERPRO:
IPR023048
INTERPRO:
IPR003680
INTERPRO:
IPR029039
MODBASE:
P41407
PDB:
2Z9D
PDB:
2Z9B
PDB:
2Z98
PDB:
2D5I
PDB:
1V4B
PDB:
1TIK
PDB:
2Z9C
PFAM:
PF02525
PRIDE:
P41407
PRODB:
PRO_000022195
REFSEQ:
NP_415930
SMR:
P41407
UNIPROT:
P41407


Operon      
Name: azoR         
Operon arrangement:
Transcription unit        Promoter
azoR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1800 1482829 forward nd [RS-EPT-CBR] [5]
  promoter azoRp1 1482873 reverse Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter azoRp6 1482927 reverse Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter azoRp8 1482991 reverse Similarity to the consensus
Read more >
[ICWHO] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Bafana A., Chakrabarti T., 2008, Lateral gene transfer in phylogeny of azoreductase enzyme., Comput Biol Chem 32(3):191-7

 [2] Cui D., Li G., Zhao D., Zhao M., 2015, Effect of quinoid redox mediators on the aerobic decolorization of azo dyes by cells and cell extracts from Escherichia coli., Environ Sci Pollut Res Int 22(6):4621-30

 [3] Ito K., Nakanishi M., Lee WC., Sasaki H., Zenno S., Saigo K., Kitade Y., Tanokura M., 2005, Crystallization and preliminary X-ray analysis of AzoR (azoreductase) from Escherichia coli., Acta Crystallogr Sect F Struct Biol Cryst Commun 61(Pt 4):399-402

 [4] Kelley KD., Olive LQ., Hadziselimovic A., Sanders CR., 2010, Look and see if it is time to induce protein expression in Escherichia coli cultures., Biochemistry 49(26):5405-7

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB