RegulonDB RegulonDB 10.9: Gene Form
   

ortT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydcY ortT yncL TSS_1818 (cluster) TSS_1818 (cluster) ydcYp3 ydcYp3 ydcXp9 ydcXp9 yncLp4 yncLp4 ydcXp7 ydcXp7 ydcXp1 ydcXp1 TSS_1817 (cluster) TSS_1817 (cluster) TSS_1816 TSS_1816

Gene      
Name: ortT    Texpresso search in the literature
Synonym(s): ECK1439, G6756, b1445, ydcX
Genome position(nucleotides): 1517389 --> 1517562 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.83
External database links:  
ASAP:
ABE-0004818
ECHOBASE:
EB3530
ECOLIHUB:
ydcX
OU-MICROARRAY:
b1445
STRING:
511145.b1445
COLOMBOS: ortT


Product      
Name: orphan toxin OrtT
Synonym(s): OrtT, YdcX
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 6.646
Isoelectric point: 10.452
Motif(s):
 
Type Positions Sequence
4 -> 57 YQHMLVFYAVMAAIAFLITWFLSHDKKRIRFLSAFLVGATWPMSFPVALLFSLF
38 -> 38 F
6 -> 26 HMLVFYAVMAAIAFLITWFLS
34 -> 54 FLSAFLVGATWPMSFPVALLF
1 -> 1 M

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0001896 - autolysis
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6756-MONOMER
ECOLIWIKI:
b1445
INTERPRO:
IPR019689
PFAM:
PF10753
PRIDE:
P64453
REFSEQ:
NP_415962
UNIPROT:
P64453


Operon      
Name: ortT         
Operon arrangement:
Transcription unit        Promoter
ortT


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1816 1517209 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1817 (cluster) 1517218 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter ydcXp1 1517221 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ydcXp7 1517236 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yncLp4 1517246 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ydcXp9 1517354 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ydcYp3 1517610 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1818 (cluster) 1517612 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB