RegulonDB RegulonDB 10.9: Gene Form
   

yncG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: yncG    Texpresso search in the literature
Synonym(s): ECK1448, G6765, b1454
Genome position(nucleotides): 1526247 --> 1526864 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.41
External database links:  
ASAP:
ABE-0004851
ECHOBASE:
EB3539
ECOLIHUB:
yncG
OU-MICROARRAY:
b1454
STRING:
511145.b1454
COLOMBOS: yncG


Product      
Name: putative glutathione S-transferase YncG
Synonym(s): YncG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.321
Isoelectric point: 4.469
Motif(s):
 
Type Positions Sequence
17 -> 79 LMLTLADIPYQFVDVSGFDHEGASRELLKTLNPLCQVPTLALENDEIMTETAAIALMVLDRRP
86 -> 205 GRAERQLFQRLLVWLVANVYPTFTFADYPERWAPDAPEQLKKNVIEYRKSLYIWLNSQLTAEPYAFGEQLTLVDCYLCTMRTWGPGHEWFQDNATNISAIADAVCQLPKLQEVLKRNEII
1 -> 82 MIKVYGVPGWGSTISELMLTLADIPYQFVDVSGFDHEGASRELLKTLNPLCQVPTLALENDEIMTETAAIALMVLDRRPDLA
66 -> 67 ET

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
Note(s): Note(s): ...[more].
Reference(s): [1] Kanai T., et al., 2006
[2] Rife CL., et al., 2003
External database links:  
ECOCYC:
G6765-MONOMER
ECOLIWIKI:
b1454
INTERPRO:
IPR004045
INTERPRO:
IPR010987
INTERPRO:
IPR036249
INTERPRO:
IPR036282
MODBASE:
P76117
PFAM:
PF13417
PRIDE:
P76117
PROSITE:
PS50404
PROSITE:
PS50405
REFSEQ:
NP_415971
SMR:
P76117
UNIPROT:
P76117


Operon      
Name: yncG         
Operon arrangement:
Transcription unit        Promoter
yncG


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB