RegulonDB RegulonDB 10.9: Gene Form
   

yddH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydcC nhoA yddH pptA TSS_1827 TSS_1827 nhoAp2 nhoAp2 TSS_1826 TSS_1826 pptAp6 pptAp6 pptAp7 pptAp7

Gene      
Name: yddH    Texpresso search in the literature
Synonym(s): ECK1456, G6769, b1462
Genome position(nucleotides): 1533282 <-- 1533851 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.23
External database links:  
ASAP:
ABE-0004877
ECHOBASE:
EB3541
ECOLIHUB:
yddH
OU-MICROARRAY:
b1462
STRING:
511145.b1462
COLOMBOS: yddH


Product      
Name: flavin reductase-like protein YddH
Synonym(s): YddH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.967
Isoelectric point: 5.931
Motif(s):
 
Type Positions Sequence
19 -> 150 GPTVLITSFDEQSQRRNIMAAAWSMPVEFEPPRVAIVVDKSTWTRELIEHNGKFGIVIPGVAATNWTWAVGSVSGRDEDKFNCYGIPVVRGPVFGLPLVEEKCLAWMECRLLPATSAQEEYDTLFGEVVSAA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0010181 - FMN binding
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6769-MONOMER
ECOLIWIKI:
b1462
INTERPRO:
IPR002563
INTERPRO:
IPR012349
MODBASE:
P76121
PFAM:
PF01613
PRIDE:
P76121
REFSEQ:
NP_415979
SMART:
SM00903
SMR:
P76121
UNIPROT:
P76121


Operon      
Name: yddH         
Operon arrangement:
Transcription unit        Promoter
yddH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter pptAp7 1532858 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter pptAp6 1532867 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1826 1533030 forward nd [RS-EPT-CBR] [2]
  promoter nhoAp2 1533963 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1827 1534000 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB