RegulonDB RegulonDB 10.9: Gene Form
   

ydeQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydeP ydeQ ydeR EvgA NagC PhoP ydePp ydePp

Gene      
Name: ydeQ    Texpresso search in the literature
Synonym(s): ECK1495, G6792, b1502
Genome position(nucleotides): 1586820 <-- 1587734 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.7
External database links:  
ASAP:
ABE-0005006
ECHOBASE:
EB3560
ECOLIHUB:
ydeQ
OU-MICROARRAY:
b1502
STRING:
511145.b1502
COLOMBOS: ydeQ


Product      
Name: putative fimbrial adhesin protein YdeQ
Synonym(s): YdeQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: pilus,extracellular space
Molecular weight: 32.07
Isoelectric point: 7.922
Motif(s):
 
Type Positions Sequence
27 -> 304 CNVDGGSSIGAGTTSVYVNLDPVIQPGQNLVVDLSQHISCWNDYGGWYDTDHINLVQGSAFAGSLQSYKGSLYWNNVTYPFPLTTNTNVLDIGDKTPMPLPLKLYITPVGAAGGVVIKAGEVIARIHMYKIATLGSGNPRNFTWNIISNNNVVMPTGGCTVDSRNVTVDLPDFPGSAEIPLGVYCSSEQKLSFYLSGATTDSSRQVFANTAPDATKASGVGVTLMRNGKILATGENVSLGTVNKSKVPLGLSATYGQTGNKVSAGTVQSVIGVTFIYE
1 -> 26 MGKTISIKVLFGIYLLLMAGKVFAFS

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
GO:0005576 - extracellular region
biological_process GO:0007155 - cell adhesion
GO:0043711 - pilus organization
GO:0043709 - cell adhesion involved in single-species biofilm formation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6792-MONOMER
ECOLIWIKI:
b1502
INTERPRO:
IPR015243
INTERPRO:
IPR008966
INTERPRO:
IPR036937
MODBASE:
P77588
PDB:
6MAW
PDB:
6MAQ
PDB:
6MAP
PFAM:
PF09160
PRIDE:
P77588
REFSEQ:
NP_416019
SMR:
P77588
SWISSMODEL:
P77588
UNIPROT:
P77588


Operon      
Name: ydeQ         
Operon arrangement:
Transcription unit        Promoter
ydeQ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB