RegulonDB RegulonDB 10.9: Gene Form
   

ydeS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydeT ydeS ydeR ydeRp1 ydeRp1

Gene      
Name: ydeS    Texpresso search in the literature
Synonym(s): ECK1497, G6794, b1504
Genome position(nucleotides): 1588309 <-- 1588839 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.82
External database links:  
ASAP:
ABE-0005013
ECHOBASE:
EB3562
ECOLIHUB:
ydeS
OU-MICROARRAY:
b1504
STRING:
511145.b1504
COLOMBOS: ydeS


Product      
Name: putative fimbrial protein YdeS
Synonym(s): YdeS
Sequence: Get amino acid sequence Fasta Format
Cellular location: pilus,extracellular space
Molecular weight: 18.949
Isoelectric point: 5.881
Motif(s):
 
Type Positions Sequence
23 -> 176 ADSVIKISGRVLDYGCTVSSDSLNFTVDLQKNSARQFPTTGSTSPAVPFQITLSECSKGTTGVRVAFNGIEDAENNTLLKLDEGSNTASGLGIEILDANMRPVKLNDLHAGMQWIPLVPEQNNILPYSARLKSTQKSVNPGLVRASATFTLEFQ
1 -> 22 MKYNNIIFLGLCLGLTTYSALS
34 -> 176 LDYGCTVSSDSLNFTVDLQKNSARQFPTTGSTSPAVPFQITLSECSKGTTGVRVAFNGIEDAENNTLLKLDEGSNTASGLGIEILDANMRPVKLNDLHAGMQWIPLVPEQNNILPYSARLKSTQKSVNPGLVRASATFTLEFQ

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
GO:0005576 - extracellular region
biological_process GO:0007155 - cell adhesion
GO:0043711 - pilus organization
GO:0043709 - cell adhesion involved in single-species biofilm formation
Note(s): Note(s): ...[more].
Reference(s): [1] Korea CG., et al., 2010
External database links:  
ECOCYC:
G6794-MONOMER
ECOLIWIKI:
b1504
INTERPRO:
IPR000259
INTERPRO:
IPR008966
INTERPRO:
IPR036937
MODBASE:
P77789
PFAM:
PF00419
PRIDE:
P77789
REFSEQ:
NP_416021
SMR:
P77789
UNIPROT:
P77789


Operon      
Name: ydeTSR         
Operon arrangement:
Transcription unit        Promoter
ydeTSR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydeRp1 1588298 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB