RegulonDB RegulonDB 10.9: Gene Form
   

ydeT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hipA ydeT ydeS yneL TSS_1836 TSS_1836

Gene      
Name: ydeT    Texpresso search in the literature
Synonym(s): ECK1498, G6795, b1505, fmlC
Genome position(nucleotides): 1588853 <-- 1590001 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.56
External database links:  
ASAP:
ABE-0005017
ECHOBASE:
EB3563
ECOLIHUB:
ydeT
OU-MICROARRAY:
b1505
STRING:
316407.85674995
COLOMBOS: ydeT


Product      
Name: fimbrial usher domain-containing protein YdeT
Synonym(s): FmlC, YdeT, fimbrial usher protein, C-terminal fragment
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 41.616
Isoelectric point: 6.634
Motif(s):
 
Type Positions Sequence
16 -> 294 QTQFIDYFNLFYSKRGQEQISISQQLGNYGTTFFSASRQSYWNTSRSDQQISFGLNVPFGDITTSLNYSYSNNIWQNDRDHLLAFTLNVPFSHWMRTDSQSAFRNSNASYSMSNDLKGGMTNLSGVYGTLLPDNNLNYSVQVGNTHGGNTSSGTSGYSSLNYRGAYGNTNVGYSRSGDSSQIYYGMSGGIIAHADGITFGQPLGDTMVLVKAPGADNVKIENQTGIHTDWRGYAILPFATEYRENRVALNANSLADNVELDETVVTVIPTHGAIARATF
303 -> 367 LMTLKYGNKSVPFGAIVTHGENKNGSIVAENGQVYLTGLPQSGQLQVSWGKDKNSNCIVEYKLPE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
molecular_function GO:0015473 - fimbrial usher porin activity
biological_process GO:0009297 - pilus assembly
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Korea CG., et al., 2010
External database links:  
ECOCYC:
G6795-MONOMER
ECOLIWIKI:
b1505
INTERPRO:
IPR025949
INTERPRO:
IPR000015
INTERPRO:
IPR042186
INTERPRO:
IPR043142
PANTHER:
PTHR30451
PFAM:
PF13953
PFAM:
PF00577
PRIDE:
P76137
REFSEQ:
NP_416022
SMR:
P76137
UNIPROT:
P76137


Operon      
Name: ydeTSR         
Operon arrangement:
Transcription unit        Promoter
ydeTSR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1836 1592159 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB