RegulonDB RegulonDB 11.0: Gene Form
   

lsrA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lsrA lsrC lsrD lsrR LsrR CRP CRP LsrR lsrAp lsrAp lsrRp lsrRp

Gene      
Name: lsrA    Texpresso search in the literature
Synonym(s): ECK1506, G6800, b1513, ego, ydeX
Genome position(nucleotides): 1601490 --> 1603025
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.32
External database links:  
ASAP:
ABE-0005056
ECHOBASE:
EB3567
ECOLIHUB:
lsrA
OU-MICROARRAY:
b1513
STRING:
511145.b1513
COLOMBOS: lsrA


Product      
Name: Autoinducer-2 ABC transporter ATP binding subunit
Synonym(s): Ego, LsrA, YdeX
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 55.821
Isoelectric point: 7.307
Motif(s):
 
Type Positions Sequence Comment
12 -> 240 LCARSVYKQYSGVNVLKGIDFTLHQGEVHALLGGNGAGKSTLMKIIAGITPADSGTLEIEGNNYVRLTPVHAHQLGIYLVPQEPLLFPSLSIKENILFGLAKKQLSMQKMKNLLAALGCQFDLHSLAGSLDVADRQMVEILRGLMRDSRILILDEPTASLTPAETERLFSRLQELLATGVGIVFISHKLPEIRQIADRISVMRDGTIALSGKTSELSTDDIIQAITPAV UniProt: ABC transporter 1.
27 -> 169 LKGIDFTLHQGEVHALLGGNGAGKSTLMKIIAGITPADSGTLEIEGNNYVRLTPVHAHQLGIYLVPQEPLLFPSLSIKENILFGLAKKQLSMQKMKNLLAALGCQFDLHSLAGSLDVADRQMVEILRGLMRDSRILILDEPTA
44 -> 51 GGNGAGKS UniProt: ATP.
240 -> 503 VREKSLSASQKLWLELPGNRPQHAAGTPVLTLENLTGEGFRNVSLTLNAGEILGLAGLVGAGRTELAETLYGLRTLRGGRIMLNGKEINKLSTGERLLRGLVYLPEDRQSSGLNLDASLAWNVCALTHNLRGFWAKTAKDNATLERYRRALNIKFNQPEQAARTLSGGNQQKILIAKCLEASPQVLIVDEPTRGVDVSARNDIYQLLRSIAAQNVAVLLISSDLEEIELMADRVYVMHQGEITHSALTERDINVETIMRVAFGD UniProt: ABC transporter 2.
280 -> 431 RNVSLTLNAGEILGLAGLVGAGRTELAETLYGLRTLRGGRIMLNGKEINKLSTGERLLRGLVYLPEDRQSSGLNLDASLAWNVCALTHNLRGFWAKTAKDNATLERYRRALNIKFNQPEQAARTLSGGNQQKILIAKCLEASPQVLIVDEPT

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0055052 - ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
molecular_function GO:0042626 - ATPase-coupled transmembrane transporter activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:1905887 - autoinducer AI-2 transmembrane transport
GO:0009372 - quorum sensing
Note(s): Note(s): ...[more].
Evidence: [ICA] Inferred by computational analysis
External database links:  
ALPHAFOLD:
P77257
ECOCYC:
YDEX-MONOMER
ECOLIWIKI:
b1513
INTERPRO:
IPR027417
INTERPRO:
IPR030281
INTERPRO:
IPR017871
INTERPRO:
IPR003593
INTERPRO:
IPR003439
MODBASE:
P77257
PANTHER:
PTHR43790:SF2
PFAM:
PF00005
PRIDE:
P77257
PRODB:
PRO_000023128
PROSITE:
PS00211
PROSITE:
PS50893
REFSEQ:
NP_416030
SMART:
SM00382
SMR:
P77257
UNIPROT:
P77257


Operon      
Name: lsrACDBFG-tam         
Operon arrangement:
Transcription unit        Promoter
lsrACDBFG-tam
tam


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: LsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB