RegulonDB RegulonDB 10.9: Gene Form
   

yneG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sad dgcF glsB yneG terminator TSS_1838 TSS_1838 yneFp7 yneFp7 TSS_1837 TSS_1837

Gene      
Name: yneG    Texpresso search in the literature
Synonym(s): ECK1516, G6809, b1523
Genome position(nucleotides): 1611966 <-- 1612325 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.78
External database links:  
ASAP:
ABE-0005084
ECHOBASE:
EB3576
ECOLIHUB:
yneG
OU-MICROARRAY:
b1523
STRING:
511145.b1523
COLOMBOS: yneG


Product      
Name: DUF4186 domain-containing protein YneG
Synonym(s): YneG
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 13.544
Isoelectric point: 10.248
Motif(s):
 
Type Positions Sequence
7 -> 112 LFARLSRSKFRSRFRLGMKERQYCLEKGAPVIEQHAADFVAKRLAPALPANDGKQTPMRGHPVFIAQHATATCCRGCLAKWHNIPQGVSLSEEQQRYIVAVIYHWL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12756N
ECOCYC:
G6809-MONOMER
ECOLIWIKI:
b1523
INTERPRO:
IPR020378
PFAM:
PF13811
PRIDE:
P76148
REFSEQ:
NP_416040
UNIPROT:
P76148


Operon      
Name: glsB-yneG         
Operon arrangement:
Transcription unit        Promoter
glsB-yneG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1837 1611861 reverse nd [RS-EPT-CBR] [1]
  promoter yneFp7 1611874 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1838 1611884 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB